DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6443 and rtf2

DIOPT Version :9

Sequence 1:NP_609443.1 Gene:CG6443 / 34477 FlyBaseID:FBgn0032290 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_593022.1 Gene:rtf2 / 2542468 PomBaseID:SPAC1D4.09c Length:240 Species:Schizosaccharomyces pombe


Alignment Length:254 Identity:72/254 - (28%)
Similarity:125/254 - (49%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCDGGTIPRRDELVRVKQKPEQKDKDAEREFR---WRHCTLTQQSLQEPIAMCGMGRLYSKQSV 62
            ||.|||::|.|:|||:...|....|.|.:|..:   :..|.:|.:.|..||..||:|:||:|.|:
pombe     1 MGNDGGSLPTRNELVKEPGKVPPLDIDFKRSVKSSQFSQCAITDEPLYPPIVSCGLGKLYNKASI 65

  Fly    63 IERLLEKEPMPETAAHVKSMKDIRQLNPTPNPAFTEEDKTEGLLDTRHSPYICKLIGLEMSGKFR 127
            ::.||::..:|::.:|:||:||:.||.       .|.|.:..:|      ::|.:....||..::
pombe    66 LQMLLDRSSVPKSPSHIKSLKDVVQLQ-------VELDDSGKVL------WLCPITRHVMSDTYQ 117

  Fly   128 FVALWSCGCVLSERALKQIKGSVASTCPLCQAAYSVEDVVVLNGNEEDMELMRVKM------EMR 186
            |..:..||.|....||||....:   |..|...|..:||:.:|.|.|.::.:..::      |..
pombe   118 FAYIVPCGHVFEYSALKQFGEKM---CFQCNQVYEEKDVIPINPNAEQLKTLSKRLLDLALSEKT 179

  Fly   187 AAKRKSSKKDKKSA--KKVEVKAEPAEEQEPVASTSKAAAAEKPTTSTKTKAVAPVKRL 243
            .:..|:|||..|:.  |:..|....::..:....|::....|...:.|....:..|||:
pombe   180 HSLNKASKKSNKNGDKKRKHVSKSNSKHAKHELRTNRMLDGENVKSETSVTDMERVKRV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6443NP_609443.1 Rtf2 1..284 CDD:282492 72/254 (28%)
rtf2NP_593022.1 Rtf2 1..239 CDD:282492 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I1695
eggNOG 1 0.900 - - E1_KOG3113
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I1595
OMA 1 1.010 - - QHG54954
OrthoFinder 1 1.000 - - FOG0004247
OrthoInspector 1 1.000 - - oto102060
orthoMCL 1 0.900 - - OOG6_102106
Panther 1 1.100 - - LDO PTHR12775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1705
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.