DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:392 Identity:105/392 - (26%)
Similarity:151/392 - (38%) Gaps:107/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LNPLNCHILLW--ETCPKRFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGF-- 103
            :.||.  :|.|  |....||:   |:|:..|.....|.:.:|:|:....|...|:|.||||||  
  Rat    39 IRPLK--LLPWSPEKINTRFL---LYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFID 98

  Fly   104 ---NGTAIDIHLQFLRDAYLSRDFNVITVDWRPLTRYPCYLHSLINTRLT-AQCTAQIYAFLTHY 164
               ....:|:    .::.:...:.|.|.|||:..:: ..|..:..|.|:. ||....|...:.:|
  Rat    99 KGEENWVVDM----CKNMFQVEEVNCICVDWKKGSQ-TTYTQAANNVRVVGAQVAQMIDILVKNY 158

  Fly   165 GAVRERITCVGHSLGAHICGMISNHLTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLH 229
            .....::..:|||||||:.|...:. |....||.||||.....|. ...:.||...||:.:.|:|
  Rat   159 SYSPSKVHLIGHSLGAHVAGEAGSR-TPGLGRITGLDPVEANFEG-TPEEVRLDPSDADFVDVIH 221

  Fly   230 TNAG----FLGQEDN--SGHLNYCVNGGRIQPFCKGNPIRK--------------SRCSHFLSIC 274
            |:|.    |||...|  ||||::..|||:..|.||.|.:.:              ..|:|..|..
  Rat   222 TDAAPLIPFLGFGTNQMSGHLDFFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYK 286

  Fly   275 YLATA----------------TFKHNKFMGVPCPN-GC----------------------LNLSG 300
            |...:                .|:.||..  |||: ||                      ||...
  Rat   287 YYLESILNPDGFAAYPCASYKDFESNKCF--PCPDQGCPQMGHYADKFAGKSGDEPQKFFLNTGE 349

  Fly   301 SKRLP--------------VSGKVNPFEFASL--IREYHIGNDAPDDARGCICIDVPYAKHCPFT 349
            :|...              |:|:|....|.|.  .|:|       |..||.|   .|.|.|....
  Rat   350 AKNFARWRYRVSLILSGRMVTGQVKVALFGSKGNTRQY-------DIFRGII---KPGATHSSEF 404

  Fly   350 DA 351
            ||
  Rat   405 DA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 76/271 (28%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 89/327 (27%)
PLAT_PL 356..467 CDD:238857 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.