DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and pnliprp2

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:315 Identity:95/315 - (30%)
Similarity:126/315 - (40%) Gaps:62/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLS-R 122
            ||:   |||...|.....:....|..:....|...|:|.||||||.....|..|..:....|. .
 Frog    55 RFL---LFTKENPDTFQEIRALTPGAISTSNFKASRKTRFIIHGFIEHGYDRWLTHMCATLLKVE 116

  Fly   123 DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTH-YGAVRERITCVGHSLGAHICGMI 186
            |.|...|||.. ..|..|..:..|.|:.....|....||:: ||.....:..:|||||:|..|..
 Frog   117 DVNCFCVDWTG-GAYALYSQAANNVRVVGAEVAHFIQFLSNQYGYSAANVHVIGHSLGSHAAGET 180

  Fly   187 SNHLTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNA-------GF-LGQEDNSGH 243
            ... |....||.|||||.|..:.... :.||...||.::.|:||:|       || :||  :.||
 Frog   181 GKR-TPGIARITGLDPAGPFFQNTPP-EVRLDQSDAQLVDVIHTDASAIFPLTGFGIGQ--SVGH 241

  Fly   244 LNYCVNGGRIQPFCKGNPIRK----------SR----CSHFLSICYLATA--------------- 279
            |::..|||:..|.||.:|..|          |:    |||..|..:...:               
 Frog   242 LDFYPNGGKNMPGCKKSPTLKYLDNYRIFKGSKEIIFCSHIRSYKFYTESILTPDAFVAFPSSDY 306

  Fly   280 -TFKHNKFMGVPCPNGCLNLSGSKRL----PVSGKVNPFEFASLIREYHIGNDAP 329
             |||  |..|.|||:|...|.|....    |.||.::.|        .:.||..|
 Frog   307 KTFK--KGTGFPCPSGGCPLMGHYAEEFLGPTSGNLSFF--------LNTGNSEP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 82/269 (30%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 95/315 (30%)
PLAT 355..466 CDD:320707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.