DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and PLA1A

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:276 Identity:79/276 - (28%)
Similarity:113/276 - (40%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFN--GTA---IDIHLQFLRDAYL 120
            :.:.||..:.|..|.  .|:....|...||:....|..|||||.  ||.   ||   .|:|....
Human    51 VQFLLFVPSNPSCGQ--LVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSWID---TFIRTLLR 110

  Fly   121 SRDFNVITVDWRPLTRYPCYLHSLINTRLTA-----QCTAQIYAFLTH---YGAVRERITCVGHS 177
            :.:.|||.|||         ::.......:|     :.:.:|..||..   .|.....|..:|.|
Human   111 ATNANVIAVDW---------IYGSTGVYFSAVKNVIKLSLEISLFLNKLLVLGVSESSIHIIGVS 166

  Fly   178 LGAHICGMISNHLTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSG 242
            ||||:.||:......:..:|.|||||.|...| .|.:.||...||..::.:||:...||.....|
Human   167 LGAHVGGMVGQLFGGQLGQITGLDPAGPEYTR-ASVEERLDAGDALFVEAIHTDTDNLGIRIPVG 230

  Fly   243 HLNYCVNGGRIQPFCKGNP------IRKSRCSHFLSICYLATATFKHNKFMGVPCPNGCLNLSGS 301
            |::|.||||:.||.|   |      .....|.|..::....:|.......|..||        .|
Human   231 HVDYFVNGGQDQPGC---PTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPC--------AS 284

  Fly   302 KRLPVSGK----VNPF 313
            .:..::|:    .|||
Human   285 YKAFLAGRCLDCFNPF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 74/248 (30%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 79/276 (29%)
Pancreat_lipase_like 49..332 CDD:238363 79/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.