DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and lipia

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:235 Identity:70/235 - (29%)
Similarity:101/235 - (42%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTA-----IDIHLQFLRDAYLSRDF 124
            |:|...|..|..|:.:.|.:  ...|:....|.|:|||:..|.     :...::||.:   .||.
Zfish    49 LYTRADPSCGQLLSHQEPFS--NSQFNVSSVTTFLIHGYRPTGSPPVWMKQFVEFLLN---RRDM 108

  Fly   125 NVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTHYGAVRERITCVGHSLGAHICGMISNH 189
            |||.|||........|...:.|||..|.....:...:...||....|..:|.||||||.|....:
Zfish   109 NVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQKMKDNGANLSSIHMIGVSLGAHISGFTGAN 173

  Fly   190 LTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRIQ 254
            ...:..||..||||.|.... :..:.||...||..::.|||:...||..:..||::|..|||..|
Zfish   174 FNGEIGRITALDPAGPEFNG-RPPEDRLDPSDALFVEALHTDMDALGYRNLLGHIDYYANGGADQ 237

  Fly   255 PFCKGNPIRKS---RCSHFLSICYLATATFKHNKFMGVPC 291
            |.|....:..|   :|.|..|:....::.......:..||
Zfish   238 PGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 70/235 (30%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.