DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG6271

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster


Alignment Length:227 Identity:76/227 - (33%)
Similarity:113/227 - (49%) Gaps:9/227 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLSR-DF 124
            :::.|||...|.....:..... ::.|..|:....|.|:|||:..:.::.....:|.|:||: |:
  Fly    68 VNFYLFTPKNPSSSKHIYATTK-SISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLSKGDY 131

  Fly   125 NVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFL-THYGAVRERITCVGHSLGAHICGMISN 188
            |||.||| ...|...|..|::....|.:..|::..|| .::|.....:..:|||||||:.|....
  Fly   132 NVIVVDW-ARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGK 195

  Fly   189 HLTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRI 253
            :...:.:.|||||||.||....|.|| ||:.|||..::.:.||.|.||.....|...:..|||:.
  Fly   196 NTDGQVHTIIGLDPALPLFSYNKPNK-RLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKT 259

  Fly   254 QPFCKGNPIR-KSRCSHFLSICYLATATFKHN 284
            ||.|   |:. ...|||..|..|.|.|..:.|
  Fly   260 QPGC---PLDVTGACSHGRSTTYYAEAVSEDN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 76/225 (34%)
CG6271NP_651526.1 Lipase 57..337 CDD:278576 76/227 (33%)
Pancreat_lipase_like 68..333 CDD:238363 76/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.