DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG6283

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster


Alignment Length:234 Identity:77/234 - (32%)
Similarity:117/234 - (50%) Gaps:9/234 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLSR-DF 124
            :::.::|.:.|..|..:..|:. ::....|:|...|.|:|||:.....|.....:..|:||: |:
  Fly    65 VNFYVYTKSNPTDGKEIKAKSG-SVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAWLSKGDY 128

  Fly   125 NVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFL-THYGAVRERITCVGHSLGAHICGMISN 188
            |||.||| ...|...|..|::..........::..:| .|:|...:.:..:|||||||:.|....
  Fly   129 NVIVVDW-ARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGK 192

  Fly   189 HLTRKQ-YRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGR 252
            .:..|: :.|:|||||.||....|..| |||.|||:.::.:.||.|.||.....|...:..|||:
  Fly   193 TVGDKRVHTIVGLDPALPLFSYDKPAK-RLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNGGK 256

  Fly   253 IQPFCKGNPIRKSRCSHFLSICYLATATFKHNKFMGVPC 291
            .||.| |.....| |||..|:.|.|.|..:.| |..:.|
  Fly   257 SQPGC-GLDATGS-CSHARSVLYYAEAVTEDN-FGSIKC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 77/232 (33%)
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.