DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG6295

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:309 Identity:90/309 - (29%)
Similarity:136/309 - (44%) Gaps:46/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ETCPKRFIDYQLFTSNGPRRGTPLNVKNPITLY--------------------KGG-FSKHRETV 97
            |...:.|.:..|.|.|   |....||.||:|.|                    .|. |:.:..|.
  Fly    38 EWMDREFAEAYLETKN---RMEGRNVLNPVTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTR 99

  Fly    98 FIIHGFNGTAIDIHLQFLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFL 161
            |.|||::.:..:.....:|||:.:. |.|:|.||| ...|...|..|::......:..|.:..|:
  Fly   100 FTIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDW-GRARSVDYASSVLAVPGVGEQVATLINFM 163

  Fly   162 -THYGAVRERITCVGHSLGAHICGMISNHLTRKQ-YRIIGLDPARPLIERMKSNKFRLSIDDANV 224
             :::|...:....:|||||||:.|....::...| :.|||||||.||......|| |||..||..
  Fly   164 RSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNK-RLSSTDAYY 227

  Fly   225 IQVLHTNAGFLGQEDNSGHLNYCVNGGRIQPFCKGNPIRKSRCSHFLSICYLATATFKHNKFMGV 289
            ::.:.||.|.||.....|...:..|||:.||.| |..:..| |:|..|:.|.|.:..::| |..:
  Fly   228 VESIQTNGGTLGFLKPIGKGAFYPNGGKSQPGC-GVDLTGS-CAHSRSVIYYAESVTENN-FPTM 289

  Fly   290 PC-------PNGCLNLSGSKRLPVSGKVNPFEFASLIREYH--IGNDAP 329
            .|       ...|.:...|.|:  ....|.:..|.   :|:  :.:|||
  Fly   290 RCGDYEEAVAKECGSSYSSVRM--GATTNAYMVAG---DYYVPVRSDAP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 79/260 (30%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 77/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.