DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and sxe2

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:285 Identity:78/285 - (27%)
Similarity:122/285 - (42%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVF--------IIHGFNGTAIDIHLQFL 115
            :.:.|.|:        ||||.:....|..|..:..|.:.|        .|||:.|.::......:
  Fly    69 KLLRYDLY--------TPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAI 125

  Fly   116 RDAYLSR-DFNVITVDWRPLT---RYPCYLHSLINTRLTAQC------TAQIYAFL-THYGAVRE 169
            :|||||| ::|||.:||...:   .||         |::.|.      .|::..|| .:.|...|
  Fly   126 KDAYLSRGNYNVIILDWSRQSLDISYP---------RVSKQLPSIAANVAKMLRFLHDNTGVPYE 181

  Fly   170 RITCVGHSLGAHICGMISNHLTRKQYR------IIGLDPARPLIERMKSNKFRLSIDDANVIQVL 228
            :|..:|||.|:||.|     ||.|..|      |..|||| .|.:.....:.||.::||..::.:
  Fly   182 QIYMIGHSAGSHISG-----LTGKLLRPHRLGAIFALDPA-GLTQLSLGPEERLDVNDALYVESI 240

  Fly   229 HTNAGFLGQEDNS-GHLNYCVNGGRIQPFCKGNPIRKSR--CSHFLSICYLATATFKHNKFMGVP 290
            ||:...||..... .|.::..|.|..||.|......:..  |.||.::.|.|.:..:...|..:.
  Fly   241 HTDLTLLGNPSTKLSHASFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALR 305

  Fly   291 CPNG-------C-LNLSGSKRLPVS 307
            |.:.       | .|:.||::..|:
  Fly   306 CSSAKSVLSATCNCNVGGSEKYAVN 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 73/257 (28%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 78/285 (27%)
Pancreat_lipase_like 72..356 CDD:238363 78/282 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.