DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG5665

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster


Alignment Length:393 Identity:98/393 - (24%)
Similarity:151/393 - (38%) Gaps:101/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KMLTSLIALLLSLLSLNPITNASKYHREALQFLLRNGNFDLNPLNCHILLWETCPK------RFI 61
            ::||.:..:..::|:..|:..||..               ::.:....|..:..|.      |.:
  Fly    37 RLLTDIATIKANILTAAPLELASNI---------------IDAVCSSTLFMDRIPAQITPDIRKM 86

  Fly    62 DYQLFTSNGPRRGTPLNVKNPITLYK-GGFSKHRETVFIIHGFNGTAIDIH-LQFLRDAYLSR-D 123
            .:|..|   |.:...:.:.....|:| ..|||.|:.|.:..|:..|..:.. :..:..|::.| |
  Fly    87 HFQYMT---PCQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGD 148

  Fly   124 FNVITVDWRPLTRY--PCYLHSLINTRLTAQCTAQIYAFLTHY-------------GAVRERITC 173
            .|.:.||   ...|  ..|..|.:||.|..:   .|...|||.             |.::|....
  Fly   149 VNFVIVD---AADYVDTFYAWSALNTDLIGE---HIGVGLTHLIELTPLRNIHLIGGFIKESFVS 207

  Fly   174 --------VGHSLGAHICGMIS---NHLTRKQY-RIIGLDPARPLIERMKSNKFRLSIDDANVIQ 226
                    |||||||||.|...   ..||.|.. ||.|||||:|...|.|... .|:..||.::.
  Fly   208 INSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILP-GLTRGDAKLVD 271

  Fly   227 VLHTNAGFLGQEDNSGHLNYCVNGGR-IQPFCKGNPIRKSRCSHFLSICYLATATFKHNK--FMG 288
            ::|||.|.|.:....|.:::...|.. |||.|     ....|||..::.|.|.:.:.|.:  |||
  Fly   272 IIHTNIGILAKRGPLGDVDFYPGGAHPIQPGC-----LTIGCSHTRAVEYFAESAYPHQEKNFMG 331

  Fly   289 VPCPN-------GCLNLSGSKRLPVSGKVNPFEFASLIREYHIGNDAPDDARGCICIDV----PY 342
            ..|.:       .|   |.....|:..::||                  .|||...:||    ||
  Fly   332 KKCASWDELRKRDC---SAGIVSPMGYRMNP------------------QARGIYYVDVNGWPPY 375

  Fly   343 AKH 345
            .::
  Fly   376 GRN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 77/262 (29%)
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 86/320 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.