DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and lipca

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:281 Identity:77/281 - (27%)
Similarity:126/281 - (44%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTSLIALLLSLLSLNPITNASKYHREALQFLLRNGN-FDLNPLNCHILLWETCPKRFIDYQLFTS 68
            :.:||.::|..|.::.:|:.:.:          .|| .|..|.....:.:|  ||..  ::::|.
Zfish     1 MKTLIKIVLCFLMISQLTDGATF----------QGNRADTEPEARMKMRYE--PKSV--FRVYTD 51

  Fly    69 NGPRRGT-PLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLSR---------- 122
            ......| .|.:..|.||...||:.......||||::       :..:.:.::||          
Zfish    52 GEYTEDTCALELFQPHTLDACGFNSSLPLAIIIHGWS-------VDGMMEKWISRLASALKSSEG 109

  Fly   123 DFNVITVDWRPLT--RYPCYLHSLINTRLTAQCTAQIYAFLTHY-----GAVRERITCVGHSLGA 180
            :.||:..||..|.  .||.   :..|||:..|..|.:.::|..:     |    ::..:|:||||
Zfish   110 NINVLIADWLTLAHQHYPI---AAQNTRIVGQDIAHLLSWLEDFKQFPLG----KVHLIGYSLGA 167

  Fly   181 HICGMISNHLT---RKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHT----NAGF-LGQ 237
            ||.|...::|.   |...||.|||||.|:.|.| |:..|||.:||..:..:||    ..|. :|.
Zfish   168 HISGFAGSNLAMSGRTLGRITGLDPAGPMFEGM-SHTDRLSPEDAKFVDAIHTFTLQRMGLSVGI 231

  Fly   238 EDNSGHLNYCVNGGRIQPFCK 258
            :....|.::..|||..||.|:
Zfish   232 KQPVAHFDFYPNGGSFQPGCQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 65/222 (29%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 65/226 (29%)
Pancreat_lipase_like 54..344 CDD:238363 64/214 (30%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.