DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG10357

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:210 Identity:63/210 - (30%)
Similarity:97/210 - (46%) Gaps:26/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IIHGFNGTAIDIHLQFLRDAYLSRDF-NVITVDWRPLTR--YPCYLHSLINTRLTAQCTAQIYA- 159
            |:||:.|:.....:..||:||.::.: ||:..||.|:..  ||       ::||..:..|||.| 
  Fly    58 IVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYP-------SSRLAVKNVAQILAK 115

  Fly   160 ----FLTHYGAVRERITCVGHSLGAHICGMISNHLTRKQYRIIGLDPARPLIERMKSNKFRLSID 220
                ||..:|...|.:..:||||||||.|.|..:......|:.|||||.||......:.  |..:
  Fly   116 LLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRSDDS--LHSN 178

  Fly   221 DANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRI-QPFCKG-NPIRKSR-------CSHFLSICYL 276
            .|..:.|:||:....|.....|.:::..|.|.. ||.|:. :.:..|:       |||..::.:.
  Fly   179 AAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFY 243

  Fly   277 ATATFKHNKFMGVPC 291
            |.:......|..|.|
  Fly   244 AESIGMPENFPAVSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 63/210 (30%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 63/210 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.