DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG13562

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:284 Identity:55/284 - (19%)
Similarity:88/284 - (30%) Gaps:68/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GFSKHRETVFIIHGFNGTAID-IHLQFLRDAYLSRDFNVITVDWRPLTRYPCYLHSLINTRLTAQ 152
            |.|...:...::||:..:..| ..|..:......|...||.:|: .:.....|:....|......
  Fly    88 GCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVICIDY-SVVASSSYMRLYTNFDTLTG 151

  Fly   153 CTAQIYAFLTHYGAVRERITCVGHSLGAHICGMISNHLTRKQYRII-----------GLDPARPL 206
            ..:.|...|...|...:|....|.|.|..:...:...|  :.:.||           |.||.  .
  Fly   152 AISSIILTLFRQGFDPKRGYMFGFSFGGQLASAVGRSL--RPHHIIESIDTCDMAGPGFDPI--A 212

  Fly   207 IERMKSNK----FRLSIDDANVIQVLHTN--AGFLGQEDNSG----HLNYCVNGGRIQPFCKGNP 261
            ::..|:.|    |..|.|....:...|.|  .|..|.:..|.    ||.                
  Fly   213 VDHSKAGKHVQCFHSSRDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLG---------------- 261

  Fly   262 IRKSRCSHFLSI-CYLATATFKHNKFMGVP-CPNGCLNLSGSKRLPVSGKVNPFEFASLIREYHI 324
                  ||.|.: .|:.|..:   .|..|. .|..|.....:.::|..              |.:
  Fly   262 ------SHGLCVDIYINTFDY---PFYAVNYTPPECFTWQKTAKIPDG--------------YTV 303

  Fly   325 GNDAPDDARGCICIDVPYAKHCPF 348
            |.:...|::....|.||.:.|.|:
  Fly   304 GYEENFDSQVTGQIFVPTSLHYPY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 44/227 (19%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 22/122 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.