DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG13282

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:316 Identity:97/316 - (30%)
Similarity:146/316 - (46%) Gaps:29/316 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NGNFDLNPLNCHILLWETCPKRFIDYQLFTSNGPRRGTPLNVKNPI---TLYKGGFSKHRETVFI 99
            |.:..:.|  |...:..:||...:.|.::|.:.|.....|::...:   .|....|:....|..|
  Fly    56 NRDITIGP--CKWAIGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKII 118

  Fly   100 IHGFNGTAIDIHLQFLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTH 163
            |||:|.......||.:|:.||:: |:|:|.|||..|:..|||:.::.||:....||||:...|..
  Fly   119 IHGYNSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVE 183

  Fly   164 YGAVRERITCVGHSLGAHICGMISNHLTRKQY-RIIGLDPARPL-IERMKSNKFRLSIDDANVIQ 226
            .|  ...|..:|.||||.:...|:.:|:.... ||.|||||.|| |...|::|  |...||:.:.
  Fly   184 TG--NTDIHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADK--LDPSDASYVD 244

  Fly   227 VLHTNAGFLGQEDNSGHLNYCVNGGRIQPFCKGNPIRKSRCSHFLSICYLATATFKHNKFMGVPC 291
            |:||||...|:.:..||.::.:|||.:||.|.|..|....|||..:..|...:......|.|..|
  Fly   245 VIHTNALVQGKMERCGHADFYMNGGIMQPGCNGQKINSFACSHQRAPAYFLESIRSPKGFWGWAC 309

  Fly   292 PNGCLNLSGSKRLPVSGKVNPFEFASLIREYHIGNDAPDDARGCICIDV----PYA 343
             :|.::.       :.|...|..|.     ...|.:.....||...||.    |:|
  Fly   310 -SGYISY-------LLGMCPPTNFL-----LEAGENIRPTTRGMFMIDTNDSSPFA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 81/235 (34%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 92/300 (31%)
Pancreat_lipase_like 75..347 CDD:238363 90/288 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.