DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG17292

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:267 Identity:73/267 - (27%)
Similarity:108/267 - (40%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RETVFIIHGF--NGTAIDIHLQFLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTA 155
            :.||..:||:  :.....||:  :.:|||.| |.|:|.:||..|........:..|.:......|
  Fly    59 KNTVLYLHGYLEDPDVESIHV--IAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELA 121

  Fly   156 QIYAFLTHYGAVRERITCVGHSLGAHICGMISNHLT------RKQYRIIGLDPARPLIERMKSNK 214
            ::...:..:|...|:...||||:|..:.|::...:|      ||..||..||||.||        
  Fly   122 KVLLKMFDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPL-------- 178

  Fly   215 F----RLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGG-RIQPFCKGNPIRKSR-------C 267
            |    .||.:||..:.|:||:|...|...::|..::..||| .:||.|   |.|..:       .
  Fly   179 FYPGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGC---PKRNYKMLSDNDLS 240

  Fly   268 SHFLSICYLATAT------------------FKHNKF--------MGVPCPNGCLNLSGSKRLPV 306
            ||..|..:.|.:.                  ||.||.        ||..||.   .:.|...|..
  Fly   241 SHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVMGHHCPT---TIHGDFYLQT 302

  Fly   307 SGKVNPF 313
            :|. .||
  Fly   303 NGH-TPF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 67/245 (27%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.