DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG7367

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:248 Identity:78/248 - (31%)
Similarity:113/248 - (45%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FSKHRETVFIIHGFNGTAIDIHLQFLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQC 153
            |:...:|..::||:..:.:...:|.:|.||:.| ..||..::|:.......||.....|....:.
  Fly   135 FNPELDTKILVHGWKSSTMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRA 199

  Fly   154 TAQIYAFLT-HYGAVRERITCVGHSLGAHICGMISNHLTRKQYRIIGLDPARPLIERMKSNKFRL 217
            .|::...|. ...|...||..:||||||||.|...::...:..||.|||||||..|.....:..|
  Fly   200 VAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIGPENHL 264

  Fly   218 SIDDANVIQVLHTNAGFLGQEDNSGHLNYCVN-GGRIQPFCKGNPIRKSRCSHFLSICYLATATF 281
            ...|||.:.|:|:.||:||.....|.:::..| ||..||.||......:.|||..|..|.|.:..
  Fly   265 DDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTGCSHGRSYEYYAESIN 329

  Fly   282 KHNKFMGVPCPNGCLNLSGSKRLPVSGKVNPFEFASLIREYHIGNDAPDDARG 334
            ....|.|||| :|...|.|..  ...||:            .:|:..|.:|||
  Fly   330 SPKGFYGVPC-SGLDELKGKN--CTGGKI------------LMGDPVPREARG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 68/205 (33%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.