DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG4267

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:352 Identity:85/352 - (24%)
Similarity:132/352 - (37%) Gaps:68/352 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLSLLSLNPITNASKYHREALQFLLRNGNFDLNP-LNCHILL------------WETCPKRFIDY 63
            ::|.|....|.:|......|:.|...:...:|:| ..|:..|            |:...|..|.:
  Fly     1 MISQLGRISIMSAVLLAFAAIVFASSSEKTELDPNATCNYTLVKKKTLGVDPSFWKKFFKHLIPF 65

  Fly    64 Q---------LFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAY 119
            .         ||..:....|..|.|.:...|...||....:|..:|||:...:...|::.:::||
  Fly    66 TSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAY 130

  Fly   120 LS-------------RDFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLT-----HYGA 166
            ||             .|||||..||...:....|..............|::..:|.     ||  
  Fly   131 LSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHY-- 193

  Fly   167 VRERITCVGHSLGAHICGMISNHLTRKQYR-IIGLDPARPLIERMKSNKFRLSIDDANVIQVLHT 230
              :.:..:||||||.|.|.....:...::. |..||||.|.. |.||:::|:...||:.::.:.|
  Fly   194 --DDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQF-REKSDEYRIDASDASYVESIQT 255

  Fly   231 NAGFLGQEDNSGHLNYCVNGGRIQPFC--KGNPIRKSRCSHFLSICYLATATFKHNKFMGVPC-- 291
            :..| |.|...||..:..|.|:.|..|  .|       |||..|..|...:......|.|..|  
  Fly   256 SVSF-GFEQPVGHATFYPNYGKNQKKCYVYG-------CSHKRSHDYFIESLTSPAGFWGPRCER 312

  Fly   292 ----------PNGCLNLSGSKRLPVSG 308
                      .:|...:.|...:|.:|
  Fly   313 HDDGTWLLLMSDGEFRMGGEPSIPKNG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 68/271 (25%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 72/289 (25%)
Pancreat_lipase_like 71..347 CDD:238363 72/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.