DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG5162

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:358 Identity:97/358 - (27%)
Similarity:137/358 - (38%) Gaps:91/358 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLIALLLSLLSLNPITNASKYHREALQFLLRNGNFDLNPLNCHILLWETCPKRFIDYQLFTSNGP 71
            ||..:....|:.|.|  .|||            :.|:|.:|  ..|...|.|:         |.|
  Fly    75 SLNVICSQALASNKI--KSKY------------SPDINKMN--FQLQTACEKK---------NFP 114

  Fly    72 RRGTPLNVKNPITLYKGGFSKHRETVFIIHGF----NGTAIDIHLQFLRDAYLSR-DFNVITVDW 131
            ........|:|:      |...::.|.:..|:    ||:..   ::....||..| |.|.:.|| 
  Fly   115 LTSPESMWKSPL------FDVKKKVVILATGWTTTVNGSDT---IEVFSKAYNCRGDVNFVAVD- 169

  Fly   132 RPLTRY--PCYLHSLINTRLTAQCTAQIYAFLTHYGAVR-------ERITCVGHSLGAHICGMIS 187
              ..|:  ..|..|..||....:..|        .|.|:       |.|..:||||||||.|...
  Fly   170 --AARFVDTLYTWSAFNTEEIGENIA--------LGLVKLLDLVPVENIHLIGHSLGAHIVGSAG 224

  Fly   188 ---NHLTRKQY-RIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCV 248
               .|||.:.. ||.|||||:|.....::.. .|...||:.:.|:|:|.|.||:.|..|.:::..
  Fly   225 RHLQHLTNQTIPRITGLDPAKPCFNEGEALS-GLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYP 288

  Fly   249 NGGRIQPFCKGNPIRKSRCSHFLSICYLATATFKHNK--FMGVPC----------------PNGC 295
            .|  :.|...|  .....|:|..|..|.|...|..|:  ||...|                |.|.
  Fly   289 GG--MSPLAAG--CFSVTCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCPGDEVPMGY 349

  Fly   296 L---NLSGSKRLPVSGKVNPFEF-ASLIREYHI 324
            .   |:.|:..|.||... ||.. ||::|..|:
  Fly   350 AVPQNIKGNYFLEVSASA-PFGMHASVVRSAHL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 70/265 (26%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 83/311 (27%)
Pancreat_lipase_like 99..365 CDD:238363 80/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.