DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and Yp3

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:288 Identity:61/288 - (21%)
Similarity:106/288 - (36%) Gaps:72/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSLNPITNASK-----YHREALQFLLRNGNFDLNPLNCHILLWETCPKRFIDYQLFTSNGPRRGT 75
            |...|:...:|     ||...::..| ..:|..:|.|  :.:|           :..|||.:...
  Fly    53 LENQPLEQGAKVIEKIYHVGQIKHDL-TPSFVPSPSN--VPVW-----------IIKSNGQKVEC 103

  Fly    76 PLNVKNPITLYKG--GFSKHRETVFI---------------------IHGFNGTAIDIHLQFLRD 117
            .||  |.:...|.  ||.:...|:.:                     :..:|...:..:.|..:.
  Fly   104 KLN--NYVETAKAQPGFGEDEVTIVLTGLPKTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQ 166

  Fly   118 AYLSRDFNVITVD-----WR----------------PLTRYPCYLHSLINTRLTAQCTAQIYAFL 161
            ...|.|::..:.:     |:                .||.:..|  ::::...|.....|....|
  Fly   167 QLKSSDYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTNFKRY--AMLDVLNTGAMIGQTLIDL 229

  Fly   162 THYGAVRERITCVGHSLGAHICGMISNHLT----RKQYRIIGLDPARPLIERMKSNKFRLSIDDA 222
            |:.|..:|.|..:|..:.||:.|...|..|    .|..||.|||||:.|.:|.:. ...||..||
  Fly   230 TNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQI-LGGLSRGDA 293

  Fly   223 NVIQVLHTNAGFLGQEDNSGHLNYCVNG 250
            :.:..:||:...:|.....|.:::..||
  Fly   294 DFVDAIHTSTFAMGTPIRCGDVDFYPNG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 51/236 (22%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 51/234 (22%)
Abhydrolase <215..396 CDD:304388 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.