DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and CG1986

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:351 Identity:99/351 - (28%)
Similarity:142/351 - (40%) Gaps:89/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIALLLSLLS----------LNPITNASKYHREALQFLLRNGNFDLNPLNCHILLWETC----PK 58
            |:..||.||.          .:|:..|.:|.:|.   :||| :.:...|| |.:::| |    .|
  Fly    10 LLGCLLCLLGDVPRIEAFHRWSPMMKAFRYLQET---MLRN-SLERAHLN-HGIVFE-CRTISAK 68

  Fly    59 RF-----IDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFN--GTAIDIHLQFLR 116
            .|     .:.||....|.||..|                :::....:||:|  |:...:....|.
  Fly    69 DFGNEVHFNLQLGDLRGFRRLDP----------------NKKLALFLHGWNDQGSKDWVQELLLT 117

  Fly   117 DAYLSRDFNVITVDWRPLTR--YPCYLHSLINTRLTAQCTAQIYAFL-----THYGAVRERITCV 174
            ......::||..|||..|::  |.....|:.:..||   .|.|...|     .|:.  |..:|..
  Fly   118 WTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLT---VAGIIMALEELRPNHFH--RSNVTLA 177

  Fly   175 GHSLGAHICGMISNHLTRKQYRIIGLDPARPL--IERMKSNKFRLSIDDANVIQVLHTNAGFLGQ 237
            |:|||||..|.....|..:..:|||||||.||  :....:.|:||...||..:|||||:.|.||.
  Fly   178 GYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGT 242

  Fly   238 EDNSGHLNYCVNGGRI-QPFCK----------GNPIRKSRCSHFLSICYLATATFKHNKFMGVPC 291
            ....||.::..||||. |..||          .||:   .|||..:..:...:......|:|..|
  Fly   243 SLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPV---SCSHSAAAIFFRQSMDPEYPFVGYEC 304

  Fly   292 PNGCLNLSGSKRLPVSGKVNPFEFAS 317
                    ||.|          |||:
  Fly   305 --------GSYR----------EFAA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 74/251 (29%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 82/288 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.