DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and Lipi

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:299 Identity:88/299 - (29%)
Similarity:131/299 - (43%) Gaps:35/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLNPITNASKYHREALQFLLRNGNFDLNPLNCHILLWETCPKRFIDYQLFTSNGPRRGTPLNVKN 81
            |.||..|     |..|:|...|....|..|        ..|...|:..:::.|..:...||...|
  Rat    28 SKNPENN-----RTCLEFSKSNAMNSLKDL--------FYPTVKINLLMYSRNNAKCAEPLFESN 79

  Fly    82 PITLYKGGFSKHRETVFIIHGF---NGTAIDIHLQFLRDAYLSRDFNVITVDWRPLTRYPCYLHS 143
              ......|:..::|::||||:   ..|.:.|| :|.:......|.|:|.|||........|..:
  Rat    80 --NSVNARFNPSKKTIWIIHGYRPLGSTPMWIH-KFTKAFLKQEDVNLIVVDWNQGATTFIYGRA 141

  Fly   144 LINTRLTAQCTAQIYAFLTHYGAVRERITCVGHSLGAHICGMISNHLTRKQYRIIGLDPARPLIE 208
            :.|||..|:...:....|..:||..:....:|.||||||||.:......:..||.|||||.|...
  Rat   142 VKNTRKVAEILREYIENLLIHGASLDNFHFIGMSLGAHICGFVGKLFQGQLGRITGLDPAGPKFS 206

  Fly   209 RMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRIQPFCKGNPIRKS---RCSHF 270
            ...|| .||...||..:.|:|:::...|..:.|||:::..||||.||.|..:.:...   :|.|.
  Rat   207 GKPSN-CRLDYTDAKFVDVIHSDSQGFGILEPSGHIDFYPNGGRNQPGCPTSLLSGMDYIKCDHQ 270

  Fly   271 LSICYLATATFKHN-KFMGVPCPN----------GCLNL 298
            .:: :|....|:.| .|:..||.:          ||.||
  Rat   271 RAV-HLFLEAFETNCNFVSFPCRSYRDYKSGLCVGCGNL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 72/236 (31%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.