DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_061362.1 Gene:Pnliprp1 / 18946 MGIID:97723 Length:473 Species:Mus musculus


Alignment Length:279 Identity:80/279 - (28%)
Similarity:120/279 - (43%) Gaps:44/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LNPLNCHILLW--ETCPKRFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGF-- 103
            :.||.  :|.|  |....||:   |:|:..|.....|.:.:|.|:....|...|:|.||||||  
Mouse    39 IRPLK--LLPWSPEKINTRFL---LYTNENPTAFQTLQLSDPSTIEASNFQVARKTRFIIHGFID 98

  Fly   104 ---NGTAIDIHLQFLRDAYLSRDFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLT--- 162
               ....:|:    .::.:...:.|.|.|||:..:: ..|..:..|.|:.....||:...|.   
Mouse    99 KGEENWVVDM----CKNMFQVEEVNCICVDWKRGSQ-TTYTQAANNVRVVGAQVAQMIDILVRNF 158

  Fly   163 HYGAVRERITCVGHSLGAHICGMISNHLTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQV 227
            :|.|  .::..:|||||||:.|...:. |....||.||||.....|. ...:.||...||:.:.|
Mouse   159 NYSA--SKVHLIGHSLGAHVAGEAGSR-TPGLGRITGLDPVEANFEG-TPEEVRLDPSDADFVDV 219

  Fly   228 LHTNAG----FLGQEDNS--GHLNYCVNGGRIQPFCKGNPIRK--------------SRCSHFLS 272
            :||:|.    |||...|.  ||.::..|||:..|.||.|.:.:              ..|:|..|
Mouse   220 IHTDAAPLIPFLGFGTNQMVGHFDFFPNGGQYMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRS 284

  Fly   273 ICYLATATFKHNKFMGVPC 291
            ..|...:....:.|...||
Mouse   285 YKYYLESILNPDGFAAYPC 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 73/257 (28%)
Pnliprp1NP_061362.1 Lipase 18..353 CDD:278576 80/279 (29%)
Pancreat_lipase_like 52..349 CDD:238363 75/264 (28%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.