DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and Lipc

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:333 Identity:90/333 - (27%)
Similarity:140/333 - (42%) Gaps:80/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTA---------IDIHLQF 114
            ||:   ||.....|.|..|..::|.||.:.||:..:..:.||||::|:.         .|..:..
Mouse    50 RFL---LFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSGSESATVGKDSDSDYQVDG 111

  Fly   115 LRDAYL-----------SRDFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTHYGAV- 167
            |.:.::           |:..||..|||..|. |..|..::.|||:..|..|.:..:|...... 
Mouse   112 LLENWIWKIVSALKSRQSQPVNVGLVDWISLA-YQHYTIAVQNTRIVGQDVAALLLWLEESAKFS 175

  Fly   168 RERITCVGHSLGAHICGMISNHLTRKQY--RIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHT 230
            |.::..:|:|||||:.|...:.:..|..  ||.|||||.|:.|....|: |||.||||.:..:||
Mouse   176 RSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPMFEGTSPNE-RLSPDDANFVDAIHT 239

  Fly   231 ----NAGF-LGQEDNSGHLNYCVNGGRIQPFCKG------------NPIRKS-RCSHFLSICYLA 277
                :.|. :|.:....|.::..|||..||.|..            |.|.:: :|:|..|: :|.
Mouse   240 FTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSV-HLF 303

  Fly   278 TATFKHNKFMGV----------------PCPNGCLNLSG----------SKRL-PVSGKVNPFEF 315
            ..:.:|:....:                .|..|..|..|          |||| .::...:||  
Mouse   304 IDSLQHSDLQSIGFQCSDMGSFSQGLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLITRAQSPF-- 366

  Fly   316 ASLIREYH 323
                :.||
Mouse   367 ----KVYH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 77/286 (27%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 86/321 (27%)
PLAT_LPL 369..504 CDD:238856 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.