DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:322 Identity:80/322 - (24%)
Similarity:124/322 - (38%) Gaps:73/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLW--ETCPKRFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTA------ 107
            |.|  |....||:   |:|.:.|.....::..|..|:....|...:.|...|.|:....      
Human    45 LPWSPEKINTRFL---LYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKWQRDM 106

  Fly   108 IDIHLQFLRDAYLSRDFNVITVDWRPLTRYPCYLHSLINTRLT-AQCTAQIYAFLTHYGAVRERI 171
            .::.||.       .|.|.|.:||...:|.  |:|::.|.|:. |:....|...:..:.....::
Human   107 CNVLLQL-------EDINCINLDWINGSRE--YIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKV 162

  Fly   172 TCVGHSLGAHICGMISNHLTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFL- 235
            ..:|||||||:.|...:.:.... ||.|||||.|.... ...:.||...|||.:.|:||||..: 
Human   163 HLIGHSLGAHLAGEAGSRIPGLG-RITGLDPAGPFFHN-TPKEVRLDPSDANFVDVIHTNAARIL 225

  Fly   236 -----GQEDNSGHLNYCVNGGRIQPFCKG----------NPIRKSR-----CSHFLSICYLATAT 280
                 |..|..|||::..|||:..|.|:.          |..:|..     |:|..|..:.|.:.
Human   226 FELGVGTIDACGHLDFYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESI 290

  Fly   281 FKHNKFMGVPC---------------PNGC--------------LNLSGSKRLPVSGKVNPF 313
            ...:.|:..||               ..||              :..:||.....:|.::||
Human   291 LNPDAFIAYPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLSPF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 68/272 (25%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 78/320 (24%)
Pancreat_lipase_like 52..348 CDD:238363 74/309 (24%)
PLAT_PL 355..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.