DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6431 and lipib

DIOPT Version :9

Sequence 1:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:225 Identity:74/225 - (32%)
Similarity:99/225 - (44%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FSKHRETVFIIHGFNGTAID-------IHLQFLRDAYLSRDFNVITVDWRPLTRYPCYLHSLINT 147
            |:..|.|.|:|||:..|...       :||     ....:|.|::.|||........||.::.||
Zfish    69 FNVTRPTTFVIHGYRPTGAPPIWINHIVHL-----LAAQKDMNILVVDWNRGAANLNYLTAVANT 128

  Fly   148 RLTAQCTAQIYAFLTHYGAVRERITCVGHSLGAHICGMISNHLTRKQYRIIGLDPARPLIERMKS 212
            |.||....:....:...||..:.|..:|.|||||:.|.|...|..:..||.|||||.|:...: |
Zfish   129 RGTALNITRFIESMEKEGASLDSIHLIGVSLGAHVAGFIGAMLGGRVGRITGLDPAGPMFASV-S 192

  Fly   213 NKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRIQPFCKGNPIR-KSR--CSH----F 270
            .:.||...||..:.||||:....|.....||:::..|||..||.|...... ||.  |.|    |
Zfish   193 PEERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYANGGLDQPGCPKTIFSGKSYFVCDHQRSVF 257

  Fly   271 LSICYLATATFKHNKFMGVPCPNGCLNLSG 300
            |.:|.|....    ...|.||.:....|||
Zfish   258 LYLCSLNRTC----SLTGYPCSSYSDFLSG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 71/216 (33%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 74/225 (33%)
Pancreat_lipase_like 40..324 CDD:238363 74/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.