DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6415 and sardh

DIOPT Version :9

Sequence 1:NP_609441.1 Gene:CG6415 / 34474 FlyBaseID:FBgn0032287 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001313615.1 Gene:sardh / 394103 ZFINID:ZDB-GENE-040426-996 Length:924 Species:Danio rerio


Alignment Length:405 Identity:95/405 - (23%)
Similarity:160/405 - (39%) Gaps:91/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RHASSAAG----EGQRTAL-YDFHVQKGGKIVNFGGYALP--VQYSDQSIIASH----------- 62
            ||.....|    :|....| ||:          :|.|.:|  ..|....|::..           
Zfish   499 RHGWERPGWFNRDGAAPVLDYDY----------YGAYNVPKNTVYKYSRILSKEYTFDFPPHHDV 553

  Fly    63 -----LHTRQVGSIFDVSHMLQSRIFGKDAAACLESVCTADILGTPEGSGSLTVFTNEAGGILDD 122
                 |..|...::||:|:..:..:.|.||....:.:.|||:...| ||...|...|:.||:..|
Zfish   554 IRDECLTCRNAVAVFDMSYFGKFYLSGPDAKKAADWLFTADVNKAP-GSTVYTCMLNQRGGVESD 617

  Fly   123 LIVNKV--SEKEL-----------YVVSNAAMKE----------QDMGIMKTAVDNFKSQGKDVS 164
            |.|:::  |...|           |:.....:.:          ||.|...|.:|:.:       
Zfish   618 LTVSRLEPSPSHLPLTPEFNGDAYYLAIGGGVAQHNWSHIQSVLQDQGFRCTLIDHTE------- 675

  Fly   165 IEFLTPADQSLVAVQGPQVAKELSKLLTGKASLDQLYFMSSFVTTLAGIPNVRITRCGYTGEDGV 229
                   |..::::|||:..:.|.::|..:.|.:...|.:..:.:.|| ..||..|..:.||.|.
Zfish   676 -------DMGMISIQGPKSRELLQEVLDSELSNEAFPFSTHRIVSAAG-HQVRAMRLSFVGEMGW 732

  Fly   230 EISVASSQAQKLTESLLESGV---LKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVT 291
            |:.:.......:..:::.:|.   :..||..|.|||.:|.|...:.:|:....||:||.||:  |
Zfish   733 ELHIPKESCLPVYNAVMAAGAKYGICNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLAF--T 795

  Fly   292 KRRRTTRDFPGADVILGQLKEGVSRRRV------GLQMLGTKPPPARSGVAIFSQGQQVGQVTSG 350
            .:.:|:..|.|...:..|..||:.||.|      .:.|.|.:        |||..|..||.:...
Zfish   796 CKLKTSIPFMGRTALEAQKAEGLRRRIVCFTVDEKVPMFGLE--------AIFRNGVPVGHLRRS 852

  Fly   351 CPSPSAGRNIAMGYV 365
            ....:..:.|..||:
Zfish   853 EFGFAIDKTIGYGYI 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6415NP_609441.1 PLN02319 3..403 CDD:177953 95/405 (23%)
GCV_T 31..288 CDD:279857 68/300 (23%)
GCV_T_C 298..392 CDD:285832 19/74 (26%)
sardhNP_001313615.1 DadA 60..444 CDD:223737
FAO_M 427..481 CDD:292961
GcvT 476..913 CDD:223481 95/405 (23%)
GCV_T 486..795 CDD:279857 74/323 (23%)
GCV_T_C 804..897 CDD:285832 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.