DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6415 and Sardh

DIOPT Version :9

Sequence 1:NP_609441.1 Gene:CG6415 / 34474 FlyBaseID:FBgn0032287 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_611263.1 Gene:Sardh / 37026 FlyBaseID:FBgn0034276 Length:894 Species:Drosophila melanogaster


Alignment Length:428 Identity:107/428 - (25%)
Similarity:181/428 - (42%) Gaps:76/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RHASSAAGEGQRTALYDFHVQKGGKIVNFGGYALPVQYSDQSIIASH-LHTRQVGSIFDVSHMLQ 79
            ||..|   |.:|....|.|            |:...:|.|  :|.|. |..|....:|::|:..:
  Fly   501 RHKDS---EYERVLDGDLH------------YSRFSEYHD--LIGSEALACRNNAVVFNMSYFAK 548

  Fly    80 SRIFGKDAAACLESVCTADILGTPEGSGSLTVFT---NEAGGILDDLIVN------------KVS 129
            ..:.|..|....:.:.:|:....|    |.||:|   |:|||:..|:.::            |::
  Fly   549 LLLDGPQAQEAADWLFSANTNRDP----SKTVYTCALNDAGGVEADVTISRLAPGSGEVYNPKIN 609

  Fly   130 EKELYVVSNAAMKEQDMGIMKTAVDNFKSQGKDVSIEFLTPADQSLVAVQGPQVAKELSKLLTGK 194
            .:..|:|:..|.......::...:   :.:|.:.|::.|| |:..::::|||...|.|..|:...
  Fly   610 GQGFYIVAGGASAFYTYSVLLAEI---RRKGFNASLKDLT-AELGVISIQGPNSRKILQPLIDCD 670

  Fly   195 ASLDQLYFMSSFVTTLA--GIPNVRITRCGYTGEDGVEISVASSQAQKLTESLLESGV---LKLA 254
            .| |:....:|  |.||  |...:|:.|..:.||.|.|:.|.......:..||:::|.   |:.|
  Fly   671 LS-DEHVAPNS--TRLAKFGDVGLRLLRVSFVGELGYELHVPKKDCAAVYRSLMKAGAGEDLRNA 732

  Fly   255 GLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTTRDFPGADVILGQLKEGVSRRRV 319
            |..:..||..|.|..|:..|:....||:||.|.:..   |:|..|:.|...|..|..||:.:|.|
  Fly   733 GYRSLYSLSSEKGYHLWSFDLRPDDTPLEAGLGFTC---RKTGADYRGKAAIENQRAEGLKKRLV 794

  Fly   320 GLQMLGTKPPPARSGVAIFSQGQQVGQVTSGCPSPSAGRNIAMGYVAENLKAPGTKV-------- 376
            .|.:....|.....||  :..|:.||.:.....:.:.|:::...||:.    |..|:        
  Fly   795 YLTLRDQVPIWGLEGV--YRNGEPVGILRRAEYAYTLGKSLGQTYVSR----PDGKIIDADYIRN 853

  Fly   377 ---EFKVRDKLYEAEV-TKMPF------VKANYYNRPK 404
               |..:..|.|.|:. .:.||      |..||.:..|
  Fly   854 GEYEVDILGKKYRADCHLRSPFDPTGQRVLGNYASESK 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6415NP_609441.1 PLN02319 3..403 CDD:177953 106/425 (25%)
GCV_T 31..288 CDD:279857 70/277 (25%)
GCV_T_C 298..392 CDD:285832 24/105 (23%)
SardhNP_611263.1 DadA 33..412 CDD:223737
NADB_Rossmann 37..>76 CDD:304358
nuc_hydro 203..>281 CDD:294156
FAO_M 398..449 CDD:292961
GcvT 446..884 CDD:223481 104/419 (25%)
GCV_T 456..767 CDD:279857 75/293 (26%)
GCV_T_C 774..867 CDD:285832 23/98 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0404
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.