DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6415 and L2HGDH

DIOPT Version :9

Sequence 1:NP_609441.1 Gene:CG6415 / 34474 FlyBaseID:FBgn0032287 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001286076.1 Gene:L2HGDH / 35156 FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster


Alignment Length:481 Identity:94/481 - (19%)
Similarity:157/481 - (32%) Gaps:192/481 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RHASSAAGEGQRTALYDFHVQKGGKIVNFGGYALPVQYSDQSIIASH-------------LHTRQ 67
            :|:||:.|:      ||..|..||.:    |.|     |.:.|:..|             |...|
  Fly    34 QHSSSSCGD------YDLVVVGGGIV----GAA-----SAREIVLRHPSLKVAVLEKECKLAKHQ 83

  Fly    68 VGSIFDVSHMLQSRIFGK----DAAACLESVCTA----DILGTP-EGSGSLTVFTNEAG-GILDD 122
            .|....|.|   :.|:.|    .|..|:|.:..|    |....| :.:|.|.|.|:|.. .:|.|
  Fly    84 SGHNSGVIH---AGIYYKPGTLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKD 145

  Fly   123 L----IVN-----------KVSEKELYVVSNAAMKEQDMGIMKTAV------DNFKSQGKDVSIE 166
            |    |.|           ::.|.|.|.....|:.....||:...:      .:||..|.|:.::
  Fly   146 LEKRGIANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLD 210

  Fly   167 F--------------------------------LT---------------PADQSLVAVQGPQ-- 182
            |                                ||               |.|..:|..:|..  
  Fly   211 FNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLL 275

  Fly   183 VAKELSKLLTGKASLDQLY--------FMS-SFVTTLAGI----PN--VRITRCGYTGEDGVEIS 232
            :.||...::.|     .:|        |:. .|...:.|.    ||  :.:.|.|||..|   |:
  Fly   276 LTKEKQHMVKG-----NIYPVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGD---IN 332

  Fly   233 VASSQAQKLTESLLESGVLKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTT 297
            :.     :|.::|...|.:|:|      |..:..||.             |.:.:|.:..:.:..
  Fly   333 LF-----ELFDALRYPGFVKMA------SKYIGFGLS-------------EMSKSWFINLQIKAL 373

  Fly   298 RDF-PGADVILGQLKEGVSRRRVGLQMLGTKPPPARSGVA----------IFSQGQQVGQVTS-- 349
            :.: |  |:....::.|              |...|:...          :|.:||..|.:..  
  Fly   374 QKYIP--DITEYDIQRG--------------PAGVRAQAMDLDGNLVDDFVFDRGQGSGALAKRV 422

  Fly   350 ----GCPSPSAGRNIAMG-YVAENLK 370
                ..|||.|..::|:. .:|:.::
  Fly   423 LHCRNAPSPGATSSLAIAKMIADKIE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6415NP_609441.1 PLN02319 3..403 CDD:177953 94/481 (20%)
GCV_T 31..288 CDD:279857 74/364 (20%)
GCV_T_C 298..392 CDD:285832 15/91 (16%)
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 84/446 (19%)
NADB_Rossmann 69..440 CDD:304358 79/421 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.