powered by:
Protein Alignment CG6415 and Yippee
DIOPT Version :9
Sequence 1: | NP_609441.1 |
Gene: | CG6415 / 34474 |
FlyBaseID: | FBgn0032287 |
Length: | 405 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_572882.1 |
Gene: | Yippee / 32295 |
FlyBaseID: | FBgn0026749 |
Length: | 121 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 27/68 - (39%) |
Gaps: | 8/68 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 TGKASLDQLYFMSSFV-----TTLAGIPNVRITRCGYTGED-GVEISVASSQAQKLTES--LLES 248
||:|.|.:.....:|. ..|.|...||...|...|.. |.....|:.::||..|. :||.
Fly 39 TGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILEY 103
Fly 249 GVL 251
.::
Fly 104 ALI 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456404 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.