DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6415 and Pdpr

DIOPT Version :9

Sequence 1:NP_609441.1 Gene:CG6415 / 34474 FlyBaseID:FBgn0032287 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001100900.1 Gene:Pdpr / 307852 RGDID:1308307 Length:878 Species:Rattus norvegicus


Alignment Length:431 Identity:98/431 - (22%)
Similarity:171/431 - (39%) Gaps:81/431 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GEGQRTA-LYDFHVQKGGKIVNFGGYALPVQYSDQSIIASHLHTRQVGSIFDVSHMLQSRIFGK- 85
            |...||: |||....:|.:.:...|:..|..:              |....|:..:.||:.|.| 
  Rat   453 GRQLRTSPLYDRLDAQGARWMEKHGFERPKYF--------------VPPNKDLLALEQSKTFYKP 503

  Fly    86 --------DAAACLESVCTADI--------------------------LGTPEGSGSLTVFTNEA 116
                    :...|.|:||..|:                          |..|.|....|...||.
  Rat   504 DWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQALESLQYLFSNDLDVPVGHIVHTGMLNEY 568

  Fly   117 GGILDDLIVNKVSEKELYVVSNAAMKEQDMGIMKTA-VDNFKSQGKDVSIEFLTPADQSLVAVQG 180
            ||..:|..:.:::::..:::|     ..|..:...| :..:..:..::.:|.:|....:|..: |
  Rat   569 GGHENDCSIARLTKRSFFMIS-----PTDQQVHCWAWLHKYLPKDSNLLLEDVTWKYTALNLI-G 627

  Fly   181 PQVAKELSKLLTGKASLDQLYFMSSFVTTLA-GIPN-VRITRCGYTGEDGVEISVASSQAQKLTE 243
            |:....||:|.....:.|  :|.:.|...:: |..| :|:....:|||.|..:.:....|..:..
  Rat   628 PRAVDVLSELSYAPMTPD--HFPTLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYN 690

  Fly   244 SLLESGV---LKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTTRDFPGADV 305
            .::..|.   ::.||..|..|||:|.....:|.|:::.|||:|......|...:..  ||.|.|.
  Rat   691 EVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLNTLTTPLECGGESRVKLEKGI--DFIGRDA 753

  Fly   306 ILGQLKEGVSRRRVGLQM------LGTKPPPARSGVAIFSQGQQVGQVTSGCPSPSAGRNIAMGY 364
            :|.|.:.||.:|.|...:      |...|   ..|..|:..|:..|:.||...|.:..|::.:||
  Rat   754 LLQQKQTGVYKRLVMFILDDHDTDLDLWP---WWGEPIYRNGKYAGKTTSSAYSYTLERHVCLGY 815

  Fly   365 VAENLKAPGTK----VEFKVRDKLYEAEVTKMPF-VKANYY 400
            |....:..|.:    .:|..|.: ||.::....| .||..|
  Rat   816 VHNFSEDSGEEQVVTADFINRGE-YEIDIAGHRFQAKAKLY 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6415NP_609441.1 PLN02319 3..403 CDD:177953 98/431 (23%)
GCV_T 31..288 CDD:279857 61/297 (21%)
GCV_T_C 298..392 CDD:285832 28/103 (27%)
PdprNP_001100900.1 DAO 44..384 CDD:279590
FAO_M 405..459 CDD:292961 2/5 (40%)
GcvT 452..867 CDD:223481 98/431 (23%)
GCV_T 462..735 CDD:279857 61/294 (21%)
GCV_T_C 747..851 CDD:285832 29/107 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.