DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6415 and SARDH

DIOPT Version :9

Sequence 1:NP_609441.1 Gene:CG6415 / 34474 FlyBaseID:FBgn0032287 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001128179.1 Gene:SARDH / 1757 HGNCID:10536 Length:918 Species:Homo sapiens


Alignment Length:414 Identity:98/414 - (23%)
Similarity:165/414 - (39%) Gaps:62/414 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSYRLPAALGGLRHASSAAGEGQRTALYDFHVQKGGKIVNFGGYALPVQYSDQSIIASHLHTRQV 68
            |.|....|.|...|...|    .|..|.|.:.           :|.|..:  .:|....|..|..
Human   520 LEYDYYGAYGSRAHEDYA----YRRLLADEYT-----------FAFPPHH--DTIKKECLACRGA 567

  Fly    69 GSIFDVSHMLQSRIFGKDAAACLESVCTADILGTPEGSGSLTVFTNEAGGILDDLIVNKVSEKE- 132
            .::||:|:..:..:.|.||....:.:.:||: ..|.||...|...|..||...||.|::::... 
Human   568 AAVFDMSYFGKFYLVGLDARKAADWLFSADV-SRPPGSTVYTCMLNHRGGTESDLTVSRLAPSHQ 631

  Fly   133 ------------LYVVSNAAMKEQDMGIMKTAVDNFKSQGKDVSIEFLTPADQSLVAVQGPQVAK 185
                        .|:....|:.:.:...:.|.:.:.|||.:.:.    :..|..::::|||....
Human   632 ASPLAPAFEGDGYYLAMGGAVAQHNWSHITTVLQDQKSQCQLID----SSEDLGMISIQGPASRA 692

  Fly   186 ELSKLLTGKASLDQLYFMSSFVTTLAGIPNVRITRCGYTGEDGVEISVASSQAQKLTESLLESGV 250
            .|.::|....|.:...|.:..:...|| ..||..|..:.||.|.|:.:..:....:..:::.:|.
Human   693 ILQEVLDADLSNEAFPFSTHKLLRAAG-HLVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGA 756

  Fly   251 ---LKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTTRDFPGADVILGQLKE 312
               |..||..|.|||.:|.|...:.:|:....:|:||.||:  |.:.::...|.|.:.:..|...
Human   757 KHGLINAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAF--TCKLKSPVPFLGREALEQQRAA 819

  Fly   313 GVSRRRVGLQMLGTKPPPARSGV-AIFSQGQQVGQVTSGCPSPSAGRNIAMGYVAENLKAPGTKV 376
            |:.||.|...|....|   ..|: ||:..||.||.|.......:..:.||.||:.:....|    
Human   820 GLRRRLVCFTMEDKVP---MFGLEAIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGP---- 877

  Fly   377 EFKVRDKLYEAEVTKMPFVKANYY 400
                         ..:.|||:..|
Human   878 -------------VSLDFVKSGDY 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6415NP_609441.1 PLN02319 3..403 CDD:177953 98/414 (24%)
GCV_T 31..288 CDD:279857 62/272 (23%)
GCV_T_C 298..392 CDD:285832 22/94 (23%)
SARDHNP_001128179.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
DadA 63..447 CDD:223737
FAO_M 430..485 CDD:292961
GcvT 479..916 CDD:223481 98/414 (24%)
GCV_T 489..798 CDD:279857 71/302 (24%)
GCV_T_C 807..>871 CDD:285832 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.