DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6415 and Sardh

DIOPT Version :9

Sequence 1:NP_609441.1 Gene:CG6415 / 34474 FlyBaseID:FBgn0032287 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_446116.1 Gene:Sardh / 114123 RGDID:621125 Length:919 Species:Rattus norvegicus


Alignment Length:377 Identity:97/377 - (25%)
Similarity:159/377 - (42%) Gaps:60/377 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LHTRQVGSIFDVSHMLQSRIFGKDAAACLESVCTADILGTPEGSGSLTVFTNEAGGILDDLIVNK 127
            |..|...::|::|:..:..:.|.||....:.:.:||: ..|.||...|...|:.||...||.|:.
  Rat   563 LACRTAAAVFNMSYFGKFYLLGADARKAPDWLFSADV-NRPPGSTVYTCMLNQRGGTESDLTVSC 626

  Fly   128 VSE-------------KELYVVSNAAMKEQDMGIMKTAVDN--FKSQGKDVSIEFLTPADQSLVA 177
            ::.             ...|:....|:.:.:...:.|.:.:  |:.|..|.|      .|..:::
  Rat   627 LAPGAQASPLAPAFEGDGYYLAVGGAVAQHNWSHINTVLQDQEFRCQLMDCS------EDLGMLS 685

  Fly   178 VQGPQVAKELSKLLTGKASLDQLYFMSSFVTTLAGIPNVRITRCGYTGEDGVEISVASSQAQKLT 242
            :|||.....|..:|....|.:...|.:..:...|| ..||..|..:.||.|.|:.|..:....:.
  Rat   686 IQGPASRDILQDVLDADLSNEAFPFSTHQLVRAAG-HLVRAIRLSFVGELGWELHVPQASCLPVY 749

  Fly   243 ESLLESGV---LKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTTRDFPGAD 304
            .:::.:|.   |..||..|.|||.:|.|...:.:|:.|..:|:||.||:  |.:.:|:..|.|.:
  Rat   750 RAVMAAGAKHGLVNAGYRAIDSLSIEKGYRHWHADLRSDDSPLEAGLAF--TCKLKTSVPFLGRE 812

  Fly   305 VILGQLKEGVSRRRVGL------QMLGTKPPPARSGVAIFSQGQQVGQVTSGCPSPSAGRNIAMG 363
            .:..|...|:.||.|.|      .|.|.:        ||:..||.||.|.......:..:.||.|
  Rat   813 ALEKQRATGLRRRLVCLTVEEEVPMFGLE--------AIWRNGQVVGHVRRADFGFTVNKTIAYG 869

  Fly   364 YVAENLKAPGTKVEFKVRDKLYEAE---VT-------KMPF------VKANY 399
            |:.:....| ..::| |::..|..|   ||       |.||      ||..|
  Rat   870 YIRDPSGGP-VSLDF-VKNGDYALERMGVTYAAQVHLKSPFDPDNKRVKGIY 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6415NP_609441.1 PLN02319 3..403 CDD:177953 97/377 (26%)
GCV_T 31..288 CDD:279857 60/242 (25%)
GCV_T_C 298..392 CDD:285832 28/109 (26%)
SardhNP_446116.1 DadA 64..448 CDD:223737
FAO_M 431..486 CDD:292961
GcvT 480..917 CDD:223481 95/373 (25%)
GCV_T 490..799 CDD:279857 61/245 (25%)
GCV_T_C 808..>872 CDD:285832 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.