DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7294 and AT2G05510

DIOPT Version :9

Sequence 1:NP_609438.1 Gene:CG7294 / 34470 FlyBaseID:FBgn0032284 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_178619.1 Gene:AT2G05510 / 815100 AraportID:AT2G05510 Length:127 Species:Arabidopsis thaliana


Alignment Length:123 Identity:53/123 - (43%)
Similarity:60/123 - (48%) Gaps:29/123 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KTLIVLA-----LLVAAVSALPQFGFGRP---------GFGGGFGGGPYGGGFGGGPYGGGFGGG 52
            |.||:|.     |:|:.|||..|.|..:|         |:.||.||...||.:|||  |.|.||.
plant     4 KALILLGLFAILLVVSEVSAARQSGMVKPESEATVQPEGYHGGHGGHGGGGHYGGG--GHGHGGH 66

  Fly    53 PYGGGFGGGPYGGGFGNPYGGG---FGGGRRHGGGRGGGGGAASASASSSASAAGGGG 107
            ..|||.|...||||.|..||||   :|||..||||...|||...          ||||
plant    67 NGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHH----------GGGG 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7294NP_609438.1 None
AT2G05510NP_178619.1 GRP 1..>51 CDD:254089 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.