DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31871 and YEH1

DIOPT Version :9

Sequence 1:NP_723607.1 Gene:CG31871 / 34463 FlyBaseID:FBgn0051871 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_013089.1 Gene:YEH1 / 850648 SGDID:S000003935 Length:573 Species:Saccharomyces cerevisiae


Alignment Length:446 Identity:122/446 - (27%)
Similarity:179/446 - (40%) Gaps:130/446 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NLLNSVLLSSNPNLAGGGRNLKSDVLEDASLITP--KLIRKYGYPSETHTVVTKDGYILEM-HRI 108
            |.|.:::||                 ||.:|:..  ....:|....|...:.|:||::::: |.|
Yeast   161 NPLQNLILS-----------------EDLTLVADLNYYFNQYNIQIEEFRLETEDGFVIDLWHLI 208

  Fly   109 P--------KKGAQPVLLMHGILDTSATWVLMGPKSGLGYMLSDLGYDVWMGNSR-GNRYSKNHT 164
            |        ||...|:|::||:|.:|.::...|.|| |.|.|...|||:|:||:| |.|...|..
Yeast   209 PKYRTTDSDKKKRPPILMLHGLLQSSGSFASNGRKS-LAYFLYQSGYDIWLGNNRCGFRPEWNEA 272

  Fly   165 SLNSDYQEFWDFTFHEMGKYDLPANIDYILSKTGYEQVHYIGHSQGTAI-FWVLCSE-------- 220
            .:.: ....||:...||.||||...||.:|:||.:|::..|.|||||.. |..|.:|        
Yeast   273 KVPT-LASRWDWDLREMVKYDLTLLIDTVLAKTQFEKLTLISHSQGTTQGFMGLVNEDKFFPPGS 336

  Fly   221 ---QPAYTQKITSMHALAPIAYIHDMKSPLFRTLVLFLDFLTAATRMLRITEFMPNTKFLVDHSQ 282
               :..:|.||.:..||||..|    ..||....:    |:...|:.:....|...|.|. :...
Yeast   337 GSKESFFTSKIANYIALAPAVY----PGPLLNEKL----FVKLMTKEIENPWFFGETSFF-EIMM 392

  Fly   283 VV---CHDNAMTQDVCSNILFLVAGYNSEQLNKTML--------PV---------MLSHTPSGAS 327
            :|   |...::...||..|...:..:| :.|..|.|        ||         .||..|:..|
Yeast   393 IVRNLCVGESLFSFVCYTIFNYLFDWN-DTLWDTALRDRHFLFSPVHVSVKLMQWWLSPDPNKVS 456

  Fly   328 IKQLEHFGQLMKSGHFRKFDRGYLRNQLEYNRMTPPDY----DLSRVKVP-VALYYSVNDLLVST 387
            .|    ||.                     ::|.|.:.    |.|  |.| :.|:....|.||..
Yeast   457 FK----FGS---------------------HKMFPDNVKWFSDAS--KAPNIYLFVPKQDRLVDG 494

  Fly   388 TGVDRLARELPNV----------IDKYLVPMERFNHLDFLWAIDV-----KPLVYN 428
               :||.....||          ||:|.       |:|.|||.||     ||::.|
Yeast   495 ---ERLINHFVNVESNVNYKIWYIDEYA-------HIDVLWAHDVIERIGKPILQN 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31871NP_723607.1 Abhydro_lipase 79..133 CDD:282003 16/64 (25%)
MhpC 93..436 CDD:223669 113/398 (28%)
Abhydrolase_5 115..281 CDD:289465 60/178 (34%)
YEH1NP_013089.1 PLN02872 169..>326 CDD:215470 57/175 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1506
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.