DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31871 and AT1G15060

DIOPT Version :9

Sequence 1:NP_723607.1 Gene:CG31871 / 34463 FlyBaseID:FBgn0051871 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:375 Identity:74/375 - (19%)
Similarity:121/375 - (32%) Gaps:114/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TLLSPFSYSSLSFKNLLNSVLLSSNPNLAGGGRNLKSDVLEDASLITPKLIRKYGYPSETHTV-V 96
            |||.|.::||       :||.|.:.|:|...                          .|.|.| |
plant    43 TLLRPRAFSS-------SSVKLPTKPSLCTA--------------------------DELHYVSV 74

  Fly    97 TKDGYILEMHR-IPKKGA----QPVLLMHGILDTSATWVLMGPKSGLGYMLSDLGYDVWMGNSRG 156
            ....:.|.:.| :|...|    .|:||:.|: .|:|....:.|.......:|..|::.|:...||
plant    75 PNTDWRLALWRYLPPPQAPTRNHPLLLLSGV-GTNAIGYDLSPGCSFARHMSGQGFETWILEVRG 138

  Fly   157 NRYSKNHTSLNSDYQEFWDFTFHEMGKYDLPANIDYILSKTGYEQVHYIGHSQGTAIFWVLCSEQ 221
            ...|...:.| .|.:|    :.||:.                    :.|..:...|.....||::
plant   139 AGLSTRVSDL-KDVEE----SAHELS--------------------NQIESTARAAAGKETCSDE 178

  Fly   222 PAYTQKITSMHALAPIAYIH--------DMKSPLFRTLVLFLD-------FLTAATRMLRITEFM 271
             ..|..|....|.||.:.:.        |....:.|....|:.       ||:....:....:..
plant   179 -KQTTDIMDSSAPAPASDVSVVGEASAWDESQLVARLTSTFMSLSERLSGFLSEGQSVFMSAKLF 242

  Fly   272 PNTKFLVDHSQVVCHDNAMTQDVCSNILFLVAGYNSEQLNKTMLPVMLSHTPSGASIKQLEHFGQ 336
            .....|||.:|:....|    |:.|.:|.|:....:..|                 :.|:....|
plant   243 DKIAMLVDDTQLYERFN----DIRSKLLSLIESKQNSGL-----------------VNQVRDLAQ 286

  Fly   337 LMKSGHFRKFDRGYLRNQLEYNRMTPPDYDL-SRVKVPVALYYSVNDLLV 385
            .:    ...||.|       ...::||..|| .|:...:..:....||:|
plant   287 RL----VNLFDDG-------QRSVSPPLIDLQERLTATIEDFQKQLDLIV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31871NP_723607.1 Abhydro_lipase 79..133 CDD:282003 14/59 (24%)
MhpC 93..436 CDD:223669 62/315 (20%)
Abhydrolase_5 115..281 CDD:289465 35/180 (19%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.