DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31871 and mag

DIOPT Version :9

Sequence 1:NP_723607.1 Gene:CG31871 / 34463 FlyBaseID:FBgn0051871 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster


Alignment Length:385 Identity:151/385 - (39%)
Similarity:222/385 - (57%) Gaps:22/385 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KSDVLEDASLITPKLIRKYGYPSETHTVVTKDGYILEMHRIP--------KKGAQPVLLMHGILD 124
            |||......:.:.:.||.:|||:|||.|.|:|||:|.:.|||        .:...|:||.||:..
  Fly    21 KSDYCLSEIVKSDERIRSHGYPTETHEVTTQDGYVLTLFRIPYSHKLKNQNEKRPPILLQHGLFS 85

  Fly   125 TSATWVLMGPKSGLGYMLSDLGYDVWMGNSRGNRYSKNHTSLNSDYQEFWDFTFHEMGKYDLPAN 189
            .|..|:..||.:.|.|:|:|.|||||:||:|||.||:|:..::.:..:||.|.:||:|..|:||.
  Fly    86 NSDCWLSSGPDNSLAYLLADAGYDVWLGNARGNIYSRNNIIISLNSHKFWHFDWHEIGTIDIPAM 150

  Fly   190 IDYILSKTGYEQVHYIGHSQGTAIFWVLCSEQPAYTQKITSMHALAPIAYIHDMKSPLFRTLVLF 254
            |||||:.||::|:||.||||||.::.|:.||:|.|...|.|.|.|||.|:.....|.:|..|...
  Fly   151 IDYILADTGFDQIHYAGHSQGTTVYLVMLSERPEYNALIKSGHLLAPCAFFEHGTSFIFNALGPL 215

  Fly   255 LDFLTAATRMLRI-TEFMPNTKF---LVDHSQVVCHDNAMTQDVCSN--ILFLVAGYNSEQLNKT 313
            :.........|.: ||.:||...   |||:|   ||   ::..:|:|  |:|...||  ...|.:
  Fly   216 VGTPGGIWNQLLVDTELIPNNNLVNRLVDNS---CH---LSNTICNNAFIMFANGGY--VNANAS 272

  Fly   314 MLPVMLSHTPSGASIKQLEHFGQLMKSGHFRKFDRGYLRNQLEYNRMTPPDYDLSRVKVPVALYY 378
            .:.|::...|:|:|..|..|:.||.||..||::|.|..:|...|.:..|||||||::..|..||.
  Fly   273 SMSVLIETHPAGSSSNQGIHYLQLWKSLKFRQYDWGTKKNNELYGQDLPPDYDLSKIVAPTHLYS 337

  Fly   379 SVNDLLVSTTGVDRLARELPNVIDKYLVPMERFNHLDFLWAIDVKPLVYNRLVRNVRRVE 438
            |.||.|.....|:.|....|::.:.|.||::.||||||:.|.::|.||.:.::..:...|
  Fly   338 STNDALCGPEDVNTLVENFPHLTEDYRVPVQSFNHLDFIIAKNMKELVNDPIIERINSYE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31871NP_723607.1 Abhydro_lipase 79..133 CDD:282003 24/61 (39%)
MhpC 93..436 CDD:223669 140/356 (39%)
Abhydrolase_5 115..281 CDD:289465 74/169 (44%)
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 24/59 (41%)
MhpC 56..366 CDD:223669 122/317 (38%)
Abhydrolase_5 76..>197 CDD:289465 60/120 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439506
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.