DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31871 and abhd-11.1

DIOPT Version :9

Sequence 1:NP_723607.1 Gene:CG31871 / 34463 FlyBaseID:FBgn0051871 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_492942.1 Gene:abhd-11.1 / 185192 WormBaseID:WBGene00009316 Length:297 Species:Caenorhabditis elegans


Alignment Length:233 Identity:54/233 - (23%)
Similarity:97/233 - (41%) Gaps:45/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LIRKYGYPSETHTVVTKDGYILEMHRIPKKGAQPVLLMHGILDTSATWVLMGPKSGLGYMLSDLG 146
            |.|::.:...|.:::..:   |....:..||. |::|:.|:..|...|:.:|..     :...||
 Worm     8 LARRFPHSDSTSSMMLAN---LTFGNMRSKGT-PLILVPGLFGTKENWIQVGKD-----LSQRLG 63

  Fly   147 YDVWMGNSRGNRYSKNHTSLNSDYQEFWDFTFHEMGKYDLPANIDYILSKTGYEQVHYIGHSQGT 211
            ..|:...:|      ||.|    :.:....|:.||.. ||...||::...||.::|:..|||.|.
 Worm    64 CMVFAVENR------NHGS----FSKAASMTYEEMAD-DLVGFIDWVRKITGEDKVNLHGHSMGG 117

  Fly   212 AIFWVLCSEQPAYTQKITSM--HALAPIAYIHDMKSPLFRTLVLFLDFLTAATRMLRITEFMPNT 274
            .....|.: .|.|:.:|.|:  ..::|:.|      ||.|.     ::|....:|:.       |
 Worm   118 KAVTQLAT-TPEYSSRIKSLIVEDMSPLGY------PLKRA-----EYLECIKQMIA-------T 163

  Fly   275 KFLVDHSQVVCHDNAMTQDVCSNILF-LVAGYNSEQLN 311
            ......|:|:..   :.:.|...:|: .|.|...|.:|
 Worm   164 DMNKSRSEVMAE---LGEKVSKVLLYQFVRGNLGEDVN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31871NP_723607.1 Abhydro_lipase 79..133 CDD:282003 11/50 (22%)
MhpC 93..436 CDD:223669 51/222 (23%)
Abhydrolase_5 115..281 CDD:289465 40/167 (24%)
abhd-11.1NP_492942.1 PRK10673 36..287 CDD:182637 48/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.