DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31871 and LIPJ

DIOPT Version :9

Sequence 1:NP_723607.1 Gene:CG31871 / 34463 FlyBaseID:FBgn0051871 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001010939.2 Gene:LIPJ / 142910 HGNCID:21773 Length:366 Species:Homo sapiens


Alignment Length:361 Identity:134/361 - (37%)
Similarity:211/361 - (58%) Gaps:16/361 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 KLIRKYGYPSETHTVVTKDGYILEMHRIP-------KKGAQPVL--LMHGILDTSATWVLMGPKS 136
            ::|..:|||.|.:.:||:|||||.::|||       |..||.|:  |.||:|.::::|:...|.:
Human     5 QIISYWGYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLAQRVVVYLQHGLLTSASSWISNLPNN 69

  Fly   137 GLGYMLSDLGYDVWMGNSRGNRYSKNHTSLNSDYQEFWDFTFHEMGKYDLPANIDYILSKTGYEQ 201
            .||::|:|.||||||||||||.:|:.|..|.:..:|||.|:|.||.||||||:||:.:.:|..|:
Human    70 SLGFILADAGYDVWMGNSRGNTWSRKHLYLETSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQEE 134

  Fly   202 VHYIGHSQGTAIFWVLCSEQPAYTQKITSMHALAPIAYIHDMKSPLFRTLVLFLDFLTAATRMLR 266
            :.|:||||||.|.::..|......::|....||||:.....:||||.|....:...:.|.:..  
Human   135 IFYVGHSQGTTIGFITFSTISKIAERIKIFFALAPVFSTKYLKSPLIRMTYKWKSIVMAFSGN-- 197

  Fly   267 ITEFMPNTKFLVDHSQVVCHDNAMTQDVCSNILFLVAGYNSEQLNKTMLPVMLSHTPSGASIKQL 331
             .:|:|.|.|.......:| ...:...:|.||||::.||:.:.||.:.|.|..||.|:|.|::.:
Human   198 -KDFLPKTSFKKFIGSKLC-PLQIFDKICLNILFMMFGYDPKNLNMSRLDVYFSHNPAGTSVQNM 260

  Fly   332 EHFGQLMKSGHFRKFDRGYL-RNQLEYNRMTPPDYDLSRVKVPVALYYSVNDLLVSTTGVDRLAR 395
            .|:.||:.|.|.:.:|.|.. .|.:.||:.|.|.|:::.:.|..|::...:|||.....|:.|..
Human   261 LHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHS 325

  Fly   396 ELPNVIDKYLVPMERFNHLDFLWAIDVKPLVYNRLV 431
            |:.|.|  |...:..:||:|.|:.:||...||:.::
Human   326 EITNHI--YYKTISYYNHIDSLFGLDVYDQVYHEII 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31871NP_723607.1 Abhydro_lipase 79..133 CDD:282003 24/60 (40%)
MhpC 93..436 CDD:223669 129/349 (37%)
Abhydrolase_5 115..281 CDD:289465 67/167 (40%)
LIPJNP_001010939.2 Abhydro_lipase 3..66 CDD:282003 24/60 (40%)
Abhydrolase_5 47..209 CDD:289465 67/164 (41%)
Abhydrolase_1 48..347 CDD:278959 111/304 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141827
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm8502
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.