DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and ZMAT1

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_005262269.2 Gene:ZMAT1 / 84460 HGNCID:29377 Length:718 Species:Homo sapiens


Alignment Length:381 Identity:70/381 - (18%)
Similarity:122/381 - (32%) Gaps:111/381 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 PDPIIPSVSSRDPHYFIQNQSHQLESAIKGLNGYTNVAQESEKPKNGYKYQPAAFADQRIVLQPK 347
            |..:.|..:...|      |...:.:|  ..:.||..|..:..........||:.|.......|.
Human     5 PSTVTPLAAESSP------QEATVSAA--SSSSYTACAAAAAAAAAAAVIVPASSATSAPACPPA 61

  Fly   348 LGQGQGQAQG--------AVPGFIPNHLQSRVAMVEPRIRQESLIKPQNPDLALPSEAHPPVPQD 404
            .|.|.|...|        |..|.....:.:|..:.|..|..|                     |:
Human    62 GGCGDGGGGGFGGSTMAAAGRGGSSFKVDTRPCLREDAIWNE---------------------QE 105

  Fly   405 LQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYANLTGRDADALG-------- 461
            ...||...:|.:|.::::.....|.||....|.:.:|      .|..:.|...:..|        
Human   106 KAELFTDKFCQVCGVMLQFESQRISHYEGEKHAQNVS------FYFQMHGEQNEVPGKKMKMHVE 164

  Fly   462 -------GAISQSEFYCKLCDLKLTSLSHAQQHFLGRRH-----RIAARH-RIRPFSDGFY---- 509
                   ..:.:::| |.||::..:|...||.|::|:.|     ::...| :..|  .||.    
Human   165 NFQVHRYEGVDKNKF-CDLCNMMFSSPLIAQSHYVGKVHAKKLKQLMEEHDQASP--SGFQPEMA 226

  Fly   510 ------DREGNWVR-TDIKYP--------MCELCDVIITSESQMAMHLAGARHR----------- 548
                  ..|..::: ..:|.|        :|.:|.:..||......|:.|:.|:           
Human   227 GVPLTTSAESTFLKPLPVKPPTAFSMRTYVCHICSIAFTSLDMFRSHMQGSEHQIKESIVINLVK 291

  Fly   549 --RRVQIAYAGESAGGMEMGIGLVPFDGSHMYRIRGNGSLAPIRPLGSQLLQGSAY 602
              |:.|.:|..|.|            |..::.:.||..:....|.:....|:...|
Human   292 NSRKTQDSYQNECA------------DYINVQKARGLEAKTCFRKMEESSLETRRY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 6/22 (27%)
ZnF_U1 613..640 CDD:197732
ZMAT1XP_005262269.2 ZnF_U1 175..209 CDD:197732 10/34 (29%)
DUF1764 612..>664 CDD:285744
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.