DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and AT2G19380

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_565450.1 Gene:AT2G19380 / 816456 AraportID:AT2G19380 Length:613 Species:Arabidopsis thaliana


Alignment Length:232 Identity:52/232 - (22%)
Similarity:86/232 - (37%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 GQAQGAVPGFIPNHLQSRVAMVEPRIRQESLIKPQNPDLALPSEAHPPVPQDLQSLF--RWNYCA 415
            |...|.|.....|...:......|.:|.......|..|..:.:|           ||  :| :|:
plant    36 GNMFGQVSVHYHNQCITEAEKYGPMVRSNGESSKQKHDFDINAE-----------LFNSQW-FCS 88

  Fly   416 LCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYA------------NLTGR-DADALGGAISQS 467
            |||..:...|....|...:.|:.:.:. :....|:            |||.: |.|...|..:..
plant    89 LCNATMTCEQDYFAHVYGKKHQEKANE-VADMDYSKQQSEHPAVDKNNLTQQPDLDIYVGLSNDY 152

  Fly   468 EFYCKLCDLKLTSLSHAQQHFLGRRHRI------AARHRIRPFSDGFYDREG---NWVRTDIK-- 521
            .::|.|||:..||......|..|::||:      |.:.:.:.......|::.   ..:..||.  
plant   153 PWFCSLCDINATSEQTLLAHANGKKHRVKVERFDAEQQKRQSTQHSTVDKKDYSKQQIEVDINVG 217

  Fly   522 ----YP-MCELCDVIITSESQMAMHLAGARHRRRVQI 553
                || .|.||:|..|.:..:..|..|.:||..|::
plant   218 LSNCYPWFCSLCNVKATCQQNLLSHANGRKHRENVEL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 7/22 (32%)
ZnF_U1 613..640 CDD:197732
AT2G19380NP_565450.1 zf-LYAR 30..57 CDD:285943 4/20 (20%)
ZnF_U1 83..116 CDD:197732 8/34 (24%)
ZnF_U1 151..185 CDD:197732 10/33 (30%)
ZnF_U1 221..255 CDD:197732 12/34 (35%)
RRM_SF 408..483 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.