DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and ZMAT4

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_016869325.1 Gene:ZMAT4 / 79698 HGNCID:25844 Length:240 Species:Homo sapiens


Alignment Length:185 Identity:44/185 - (23%)
Similarity:70/185 - (37%) Gaps:27/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 SEFYCKLCDLKLTSLSHAQQHFLGRRH--RIAARHRIRPFSDGFYD---REGNWVRTDI--KYPM 524
            ::.|||:|..:|.|.|....|:..|:|  ::...:.:.|...|...   |..|....|:  |...
Human    12 TDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKC 76

  Fly   525 CELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIGLVPFDGSHMYRIRGNGSLAPI 589
            |.||::..||......|..|..|.:|::: ..||..   .:.....|              |:|:
Human    77 CTLCNMSFTSAVVADSHYQGKIHAKRLKL-LLGEKT---PLKTTATP--------------LSPL 123

  Fly   590 RPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQGRMHRRNMHRL 644
            :|.........|.|....|...  ||..|....|:.....||..|:.|::|..|:
Human   124 KPPRMDTAPVVASPYQRRDSDR--YCGLCAAWFNNPLMAQQHYDGKKHKKNAARV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 7/22 (32%)
ZnF_U1 613..640 CDD:197732 8/26 (31%)
ZMAT4XP_016869325.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - otm51493
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.