DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and zgc:171482

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_005157109.2 Gene:zgc:171482 / 796610 ZFINID:ZDB-GENE-080204-84 Length:254 Species:Danio rerio


Alignment Length:271 Identity:55/271 - (20%)
Similarity:87/271 - (32%) Gaps:86/271 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 QSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCY-----------ANLTGRDADA 459
            :.||..:||.:||..:.|....:.||.|:.|..:     ||..|           ..|...:.|:
Zfish    30 EGLFTESYCNICNAQLISESQRVAHYESKKHANK-----VRLFYMLHPEDGGPPSKRLRPDNPDS 89

  Fly   460 LGGAISQSEFYCKLCDLKLTSLSHAQQHFLGRRHRIAARHRI---------------RPFSDGFY 509
            ....:.::: .|.||::..||...||.|:.|:.|  |.|.|:               .|.|....
Zfish    90 AENEVDRNK-CCTLCNMFFTSAIVAQSHYQGKTH--AKRVRLVLGETPSLPTPTDSAPPTSQTTE 151

  Fly   510 DREGNWVRTDIKYPM---------CELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEM 565
            .....|      .|:         |.||.....:......|..|.:|:|....|...|...|   
Zfish   152 PPPPTW------QPLANNGEAGKYCCLCGAWFNNPLMAQQHYEGKKHKRNAARARLLEQLAG--- 207

  Fly   566 GIGLVPFDGSHMYRIRGNGSLAPIRPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQ 630
                 ..|.:....:|.:                             :.|..||:.||.::..:.
Zfish   208 -----SLDANESTGLRRS-----------------------------YSCSVCNVVLNSIEQYHA 238

  Fly   631 HEQGRMHRRNM 641
            |.||..|:.|:
Zfish   239 HLQGSKHQNNL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 5/31 (16%)
ZnF_U1 613..640 CDD:197732 9/26 (35%)
zgc:171482XP_005157109.2 zf-met 37..60 CDD:289631 8/22 (36%)
C2H2 Zn finger 38..60 CDD:275371 7/21 (33%)
ZnF_U1 95..129 CDD:197732 13/36 (36%)
C2H2 Zn finger 100..122 CDD:275371 9/21 (43%)
ZnF_U1 167..198 CDD:197732 7/30 (23%)
C2H2 Zn finger 170..192 CDD:275371 5/21 (24%)
C2H2 Zn finger 223..245 CDD:275371 8/21 (38%)
zf-met 223..245 CDD:289631 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - otm25991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.