DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and Zmat4

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001128219.1 Gene:Zmat4 / 684961 RGDID:1584398 Length:229 Species:Rattus norvegicus


Alignment Length:268 Identity:57/268 - (21%)
Similarity:89/268 - (33%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 QSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRK-----CYANL----TGRDADALG 461
            |.||..:||.:|:..:.|....:.||.||.|..::..:.:..     |.|..    .|.|||.: 
  Rat     8 QDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRAENGSDADMV- 71

  Fly   462 GAISQSEFYCKLCDLKLTSLSHAQQHFLGRRH--RI---------------------AARHRIRP 503
                .....|.||::..||...|..|:.|:.|  |:                     |.|....|
  Rat    72 ----DKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPLTSLKAPRVDTAP 132

  Fly   504 FSDGFYDREGNWVRTDIKYPMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIG 568
            .....|.|     |...:|  |.||.....:......|..|.:|::..                 
  Rat   133 MVASPYQR-----RDSDRY--CGLCAAWFNNPLMAQQHYDGKKHKKNA----------------- 173

  Fly   569 LVPFDGSHMYRIRGNGSLAPIRPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQ 633
                           ..:|.:..||:.|..|....|..|     :.|..|:::||.::..:.|.|
  Rat   174 ---------------ARVALLEQLGTSLDLGELRGLRRT-----YRCTTCSVSLNSIEQYHAHLQ 218

  Fly   634 GRMHRRNM 641
            |..|:.|:
  Rat   219 GSKHQTNL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 5/22 (23%)
ZnF_U1 613..640 CDD:197732 8/26 (31%)
Zmat4NP_001128219.1 zf-met 15..38 CDD:403930 8/22 (36%)
C2H2 Zn finger 16..38 CDD:275371 7/21 (33%)
ZnF_U1 72..106 CDD:197732 10/33 (30%)
C2H2 Zn finger 77..99 CDD:275371 8/21 (38%)
ZnF_U1 142..176 CDD:197732 7/67 (10%)
C2H2 Zn finger 147..169 CDD:275371 5/21 (24%)
zf-met 198..222 CDD:403930 7/23 (30%)
C2H2 Zn finger 200..222 CDD:275371 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - mtm9021
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.