DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and Zmat3

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_071993.1 Gene:Zmat3 / 64394 RGDID:620134 Length:289 Species:Rattus norvegicus


Alignment Length:298 Identity:67/298 - (22%)
Similarity:101/298 - (33%) Gaps:108/298 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 PRIRQESLIKPQNPDLALPSEAHPPVPQDLQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRI 440
            |...:|.|.|...||.||.....|        ||    |.|||:.:.|.|.|..||..:.|.:::
  Rat    46 PLAGEEDLAKRGEPDSALEELCKP--------LF----CKLCNVTLNSAQQAQAHYQGKNHGKKL 98

  Fly   441 SS-WLVRKC-----YANLTGRDADAL------------GGAI--SQSEFYCKLCDLKLTSLSHAQ 485
            .: :....|     .:::....|..|            ||.:  :....||||||...:|.:.||
  Rat    99 RNYYAANSCPPPARMSSVAEPVATPLVPVPPQVGSCKPGGRVILATENDYCKLCDASFSSPAVAQ 163

  Fly   486 QHFLGRRHRIAARHRI-----RPFSDGFYDREGNWVRTDIKYPMCELCDVIITSESQMAMHLAGA 545
            .|:.|:.|  |.|.|:     ..|||                          ::|       ||.
  Rat   164 AHYQGKNH--AKRLRLAEAQSHSFSD--------------------------SAE-------AGQ 193

  Fly   546 RHRRRVQIAYAGESAGGMEMGIGLVPFDGS---------HMYRIRGNGSLAPIRPLGSQLLQGSA 601
            |..|:                      :||         :||.::.|.  .|.  ..::..|...
  Rat   194 RRTRK----------------------EGSEFKMVTTRRNMYTVQSNS--GPY--FNARSRQRIP 232

  Fly   602 YPLSL-TDPSAVFYCDACNITLNHLKSVNQHEQGRMHR 638
            ..|:: ..||..|||..||:.........||.:.:.|:
  Rat   233 RDLAMCVTPSGQFYCSMCNVGAGEEVEFRQHLESKQHK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 3/22 (14%)
ZnF_U1 613..640 CDD:197732 8/26 (31%)
Zmat3NP_071993.1 ZnF_U1 67..101 CDD:197732 13/45 (29%)
C2H2 Zn finger 72..94 CDD:275371 9/21 (43%)
ZnF_U1 144..177 CDD:197732 14/34 (41%)
C2H2 Zn finger 149..171 CDD:275371 10/21 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..202 9/76 (12%)
ZnF_U1 242..276 CDD:197732 9/29 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..289 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9021
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46786
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.