DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and znf346

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001075218.1 Gene:znf346 / 560756 ZFINID:ZDB-GENE-070209-152 Length:301 Species:Danio rerio


Alignment Length:259 Identity:53/259 - (20%)
Similarity:95/259 - (36%) Gaps:43/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 NVAQESEKPKNGYKYQPAAFADQRIVLQPK---LGQGQGQAQGAVPGFIPN-----HLQSRVAMV 374
            |:..:.| |...:.|.|:..|:...:::..   ....|.:...||  .|..     |.||:....
Zfish    20 NIMAQQE-PNGDFPYLPSGAAEVNRMIKENSDLFSDSQCKVCSAV--LISESQKLAHYQSKKHAS 81

  Fly   375 EPRIRQESL----------IKPQNPDLALPSEAHPPVPQDLQSLFRWNYCALCNMVIRSTQSAID 429
            :.| |..|:          .||...|.:...|..           ::..|::|||...|...|..
Zfish    82 KVR-RYMSIHGSEEPIAKRFKPSGDDQSNVDEKD-----------KYKACSVCNMTFSSPVVAQS 134

  Fly   430 HYSSRAHERRISSWLVRKCYANLTGRDADA------LGGAISQSEFYCKLCDLKLTSLSHAQQHF 488
            ||..:.|.:.:....:......|...:|.|      .|.|......:|.:|.....:...||||:
Zfish   135 HYQGKVHSKNLRMQSIGSQTPALPQPEAQAKKDDGMQGPAEQDPNRFCSICQASFNNPLMAQQHY 199

  Fly   489 LGRRHRIAARHRIRPFSDGFYDREGNWVRTDIKYPMCELCDVIITSESQMAMHLAGARHRRRVQ 552
            .|::|:   :|..:......:........|...|| |.:|::.:.|..|...|::|::|:...:
Zfish   200 SGKKHK---KHMNKQKLMETFGPSTAPASTVKGYP-CTVCNIELNSVEQYQAHISGSKHKNHAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 6/22 (27%)
ZnF_U1 613..640 CDD:197732
znf346NP_001075218.1 ZnF_U1 57..86 CDD:197732 7/31 (23%)
C2H2 Zn finger 57..79 CDD:275371 6/23 (26%)
ZnF_U1 119..148 CDD:197732 9/28 (32%)
C2H2 Zn finger 119..141 CDD:275371 8/21 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..177 5/25 (20%)
ZnF_U1 177..211 CDD:197732 9/36 (25%)
C2H2 Zn finger 182..204 CDD:275371 7/21 (33%)
C2H2 Zn finger 232..254 CDD:275371 6/21 (29%)
zf-met 232..254 CDD:289631 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..283 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6359
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.