DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and KRCC1

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001291455.1 Gene:KRCC1 / 51315 HGNCID:28039 Length:259 Species:Homo sapiens


Alignment Length:112 Identity:22/112 - (19%)
Similarity:35/112 - (31%) Gaps:35/112 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 DLALPSEAHPPVPQDLQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYANLTG 454
            |..||||.....|:.            ||:             .:..|.|:..|        |..
Human    60 DQRLPSETIQTYPRS------------CNI-------------PQTVENRLPQW--------LPA 91

  Fly   455 RDADALGGAISQSEFYCKLCDLKLTSLSHAQQHFLGRRHRIAARHRI 501
            .|:.....::|..:|.......|...|:..||.::...|.:  .||:
Human    92 HDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGV--EHRV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631
ZnF_U1 613..640 CDD:197732
KRCC1NP_001291455.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..259
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.