DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and CG1231

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster


Alignment Length:317 Identity:93/317 - (29%)
Similarity:143/317 - (45%) Gaps:68/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GFIPNHLQSRVAMVEPRIRQESLIKPQNPDLALPSEAHPPVPQDLQSLFRWNYCALCNMVIRSTQ 425
            |.|..:::.:...:|    ::||  ..|.||||........|::|..|.....|.||.:.:.|.:
  Fly    57 GSIRTNMKRKAKCME----EDSL--KANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRK 115

  Fly   426 SAIDHYSSRAHERRISSWLVRKCYANLTGRDAD-----ALGGAISQSEFYCKLCDLKLTSLSHAQ 485
            .|.|||.|:||:|.||:||. |.|..: |.:|.     |..|....:.|:|:||:|.|||..||:
  Fly   116 RARDHYESKAHDRHISAWLA-KNYTEV-GLEAPPVKRLAKQGPTGPNAFHCELCNLDLTSSMHAR 178

  Fly   486 QHFLGRRHR---------IAARH---RIRPFSDGFYDR----------------EGNWVRTDIKY 522
            ||:|||:|:         ..|||   .:..:..|...|                |.:.:::|...
  Fly   179 QHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNE 243

  Fly   523 PMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIGLVPFDGSHMYRIRGNGSLA 587
            ..|.||.:::||.:||..|||||||::..:.:                        |...|.|.|
  Fly   244 RTCHLCKIVVTSAAQMQAHLAGARHQKNWRTS------------------------RQDQNHSEA 284

  Fly   588 PIRPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQGRMHRRNMHRL 644
            ||..  ::.|..:...|..| |...:||..||:.:||..::.||..|:.|.:.:..|
  Fly   285 PIPE--TEKLDAAELALYRT-PMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKNL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 12/22 (55%)
ZnF_U1 613..640 CDD:197732 10/26 (38%)
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 22/60 (37%)
zf-met 104..126 CDD:289631 9/21 (43%)
zf-met 163..186 CDD:289631 14/22 (64%)
C2H2 Zn finger 164..186 CDD:275371 14/21 (67%)
UFD2 255..>338 CDD:227443 30/109 (28%)
ZnF_U1 304..336 CDD:197732 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448369
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CKPU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - otm24553
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46786
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.