DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and Zmat4

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_006509202.1 Gene:Zmat4 / 320158 MGIID:2443497 Length:243 Species:Mus musculus


Alignment Length:268 Identity:57/268 - (21%)
Similarity:89/268 - (33%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 QSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRK-----CYANL----TGRDADALG 461
            |.||..:||.:|:..:.|....:.||.||.|..::..:.:..     |.|..    .|.|||.: 
Mouse    22 QDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRAENGSDADMV- 85

  Fly   462 GAISQSEFYCKLCDLKLTSLSHAQQHFLGRRH--RI---------------------AARHRIRP 503
                .....|.||::..||...|..|:.|:.|  |:                     |.|....|
Mouse    86 ----DKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPLSSLKAPRVDTAP 146

  Fly   504 FSDGFYDREGNWVRTDIKYPMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIG 568
            .....|.|     |...:|  |.||.....:......|..|.:|::..                 
Mouse   147 VVASPYQR-----RDSDRY--CGLCAAWFNNPLMAQQHYEGKKHKKNA----------------- 187

  Fly   569 LVPFDGSHMYRIRGNGSLAPIRPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQ 633
                           ..:|.:..||:.|..|....|..|     :.|..|:::||.::..:.|.|
Mouse   188 ---------------ARVALLEQLGTSLDLGELRGLRRT-----YRCTTCSVSLNSIEQYHAHLQ 232

  Fly   634 GRMHRRNM 641
            |..|:.|:
Mouse   233 GSKHQTNL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 5/22 (23%)
ZnF_U1 613..640 CDD:197732 8/26 (31%)
Zmat4XP_006509202.1 ZnF_U1 29..59 CDD:197732 9/29 (31%)
C2H2 Zn finger 30..52 CDD:275371 7/21 (33%)
ZnF_U1 86..120 CDD:197732 10/33 (30%)
C2H2 Zn finger 91..113 CDD:275371 8/21 (38%)
ZnF_U1 156..190 CDD:197732 7/67 (10%)
C2H2 Zn finger 161..183 CDD:275371 5/21 (24%)
PRP11 179..>243 CDD:227571 18/99 (18%)
C2H2 Zn finger 214..236 CDD:275371 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - mtm8774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.