DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and Zfp346

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_006253690.1 Gene:Zfp346 / 306765 RGDID:1308068 Length:306 Species:Rattus norvegicus


Alignment Length:240 Identity:53/240 - (22%)
Similarity:83/240 - (34%) Gaps:43/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 QDLQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYANLTG----RDADALGGA 463
            |..|.||....|.:|..::.|....:.||.|:.|..::..:|.......|.|    .|:|.....
  Rat    76 QKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGDVKRLDSDQKSSR 140

  Fly   464 ISQSEFYCKLCDLKLTSLSHAQQHFLGRRHRIAARHRIRPFSDGFYDREGNWVRTDIKYPMCELC 528
            .......|.:|::..:|...||.|:||:.|....:.:.:|.......:....:..|   ..|.||
  Rat   141 SKDKNHCCPVCNMTFSSPVVAQSHYLGKTHARNLKLKQQPAKGAALQQHRETLDPD---KFCSLC 202

  Fly   529 DVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIGLVPFDGSHMYRIRGNGSLAPIRPLG 593
            .......:....|..|.|||::             |..:.|:    :|..|:.|        |..
  Rat   203 HSAFNDPAMAQQHYTGKRHRKQ-------------ETKLKLM----AHYGRLAG--------PTA 242

  Fly   594 SQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQGRMHR 638
            |....|..||           |..|.|.||.::....|..|..|:
  Rat   243 SDSPAGKGYP-----------CKTCKIVLNSIEQYQAHVSGFKHK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 5/22 (23%)
ZnF_U1 613..640 CDD:197732 8/26 (31%)
Zfp346XP_006253690.1 ZnF_U1 87..116 CDD:197732 7/28 (25%)
C2H2 Zn finger 87..109 CDD:275371 6/21 (29%)
ZnF_U1 143..176 CDD:197732 9/32 (28%)
C2H2 Zn finger 148..170 CDD:275371 8/21 (38%)
ZnF_U1 194..228 CDD:197732 10/49 (20%)
C2H2 Zn finger 199..221 CDD:275371 5/21 (24%)
C2H2 Zn finger 253..275 CDD:275371 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - mtm9021
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6359
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.