DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and Zfp385d

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_017455135.2 Gene:Zfp385d / 305691 RGDID:1359606 Length:447 Species:Rattus norvegicus


Alignment Length:434 Identity:84/434 - (19%)
Similarity:140/434 - (32%) Gaps:145/434 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 QNQSHQLESAIKGLNGYTNVAQESEKPKNGYKYQPAAFADQRIVLQPKLGQGQGQAQG-AVPGFI 363
            |.:.|...:.....|...|.|.:::...||..:|...   :::.....:..|.|..|. |:|   
  Rat    11 QEKKHSNFTFCSVCNIQLNSATQAQIHYNGKSHQKRL---KQLTKGVPMSDGGGTCQSPALP--- 69

  Fly   364 PNHLQSRVAMVEPRI--RQESL-IKPQNP---DLALPSEAHP-------------------PVPQ 403
                    |::.|..  .|.|| |||..|   |.|......|                   |:|.
  Rat    70 --------ALIHPPAPPLQPSLDIKPFLPFPLDTAATVNLFPNFNAMDPIQKAVINHTFGVPLPH 126

  Fly   404 DLQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSW--------------LVRKCYANLT- 453
            ..:.:..   |.:|.:...|...|..||....|.:::.:.              ..:..:.::| 
  Rat   127 RKKQIIS---CNICQLRFNSDSQAAAHYKGTKHAKKLKALESMKNKQKSVTAKDSAKTTFTSITT 188

  Fly   454 -------------------GRDAD-----------------ALGGAISQSE-------------- 468
                               .|.||                 :|..|::...              
  Rat   189 NPITTSSDKTESTAGTQVIARSADMRKSSEVTTELTSNAEKSLTAAVAAGNNSSPPTETEEEKAK 253

  Fly   469 --FYCKLCDLKLTSLSHAQQHFLGRRHR--IAARH---RIRPFSDGFYDREG--NWVRTDI--KY 522
              .||.||.:.:.|.|..:.|..|.:|:  :.||:   .|:.|.......:|  |...|.:  |.
  Rat   254 RLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGTIKAFPRAGMKGKGPVNKGNTGLQNKT 318

  Fly   523 PMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIGLVPFD----GSHMYRIRGN 583
            ..||:|||.:.||:|:..|::..||:.|         |.|........|::    .:|...::..
  Rat   319 FHCEICDVHVNSETQLKQHISSRRHKDR---------ASGKPPKPKYSPYNKLQKAAHPLGVKLV 374

  Fly   584 GSLAPIRPLGSQLLQGSA------------YPLSL-TDPSAVFY 614
            .|..|.:||..::|....            .|.|| |.|:|..:
  Rat   375 FSKEPSKPLTPRILPNPLAAAAAAAAVAVNSPFSLRTAPAATLF 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 9/22 (41%)
ZnF_U1 613..640 CDD:197732 0/2 (0%)
Zfp385dXP_017455135.2 zf-met 20..43 CDD:403930 5/22 (23%)
C2H2 Zn finger 134..156 CDD:275371 6/21 (29%)
zf-met 134..156 CDD:403930 6/21 (29%)
YjdB <184..282 CDD:227779 15/97 (15%)
zf-met 256..280 CDD:403930 8/23 (35%)
C2H2 Zn finger 258..320 CDD:275371 16/61 (26%)
zf-met 319..343 CDD:403930 9/23 (39%)
C2H2 Zn finger 321..343 CDD:275371 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.800

Return to query results.
Submit another query.